Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG27_RS00790 Genome accession   NZ_CP094147
Coordinates   168561..168686 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe027     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 163561..173686
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG27_RS00765 (MPG27_00765) - 163626..165845 (+) 2220 WP_245042649.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG27_RS00770 (MPG27_00770) panD 165835..166185 (+) 351 WP_073470207.1 aspartate 1-decarboxylase -
  MPG27_RS00775 (MPG27_00775) - 166196..166489 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG27_RS00780 (MPG27_00780) - 166489..167484 (+) 996 WP_245043310.1 PDZ domain-containing protein -
  MPG27_RS00785 (MPG27_00785) comB6 167490..168545 (+) 1056 WP_245042652.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG27_RS00790 (MPG27_00790) comB7 168561..168686 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG27_RS00795 (MPG27_00795) comB8 168683..169426 (+) 744 WP_245042654.1 virB8 family protein Machinery gene
  MPG27_RS00800 (MPG27_00800) comB9 169426..170388 (+) 963 WP_245042656.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG27_RS00805 (MPG27_00805) comB10 170381..171517 (+) 1137 WP_245042658.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG27_RS00810 (MPG27_00810) - 171587..172999 (+) 1413 WP_245042667.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667590 MPG27_RS00790 WP_001217874.1 168561..168686(+) (comB7) [Helicobacter pylori strain Hpfe027]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667590 MPG27_RS00790 WP_001217874.1 168561..168686(+) (comB7) [Helicobacter pylori strain Hpfe027]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment