Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ODQ18_RS03465 Genome accession   NZ_CP107039
Coordinates   627354..627737 (+) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain 11060     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 622354..632737
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ODQ18_RS03435 (ODQ18_03435) corA 622808..623761 (+) 954 WP_029317911.1 magnesium transporter CorA -
  ODQ18_RS03440 (ODQ18_03440) comGA 624172..625242 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ODQ18_RS03445 (ODQ18_03445) comGB 625229..626266 (+) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  ODQ18_RS03450 (ODQ18_03450) comGC 626280..626576 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ODQ18_RS03455 (ODQ18_03455) comGD 626566..626997 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ODQ18_RS03460 (ODQ18_03460) comGE 626981..627328 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ODQ18_RS03465 (ODQ18_03465) comGF 627354..627737 (+) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  ODQ18_RS03470 (ODQ18_03470) comGG 627738..628112 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  ODQ18_RS03475 (ODQ18_03475) spoIITA 628183..628362 (+) 180 WP_003230176.1 YqzE family protein -
  ODQ18_RS03480 (ODQ18_03480) yqzG 628404..628730 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ODQ18_RS03485 (ODQ18_03485) tapA 629002..629763 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  ODQ18_RS03490 (ODQ18_03490) sipW 629747..630319 (+) 573 WP_003246088.1 signal peptidase I SipW -
  ODQ18_RS03495 (ODQ18_03495) tasA 630383..631168 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  ODQ18_RS03500 (ODQ18_03500) sinR 631261..631596 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ODQ18_RS03505 (ODQ18_03505) sinI 631630..631803 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=640222 ODQ18_RS03465 WP_041850015.1 627354..627737(+) (comGF) [Bacillus subtilis strain 11060]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=640222 ODQ18_RS03465 WP_041850015.1 627354..627737(+) (comGF) [Bacillus subtilis strain 11060]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984