Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   N7985_RS16155 Genome accession   NZ_CP106673
Coordinates   3112600..3112740 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM116268     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3107600..3117740
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N7985_RS16130 (N7985_16130) yuxO 3107943..3108323 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  N7985_RS16135 (N7985_16135) comA 3108342..3108986 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  N7985_RS16140 (N7985_16140) comP 3109067..3111367 (-) 2301 WP_088300729.1 histidine kinase Regulator
  N7985_RS16145 (N7985_16145) comX 3111379..3111543 (-) 165 WP_015384519.1 competence pheromone ComX -
  N7985_RS16150 (N7985_16150) comQ 3111556..3112416 (-) 861 WP_041850585.1 polyprenyl synthetase family protein Regulator
  N7985_RS16155 (N7985_16155) degQ 3112600..3112740 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  N7985_RS16160 (N7985_16160) - 3112962..3113024 (+) 63 Protein_3124 hypothetical protein -
  N7985_RS16165 (N7985_16165) - 3113203..3113571 (+) 369 WP_041850584.1 hypothetical protein -
  N7985_RS16170 (N7985_16170) pdeH 3113547..3114776 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  N7985_RS16175 (N7985_16175) pncB 3114913..3116385 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  N7985_RS16180 (N7985_16180) pncA 3116401..3116952 (-) 552 WP_043940186.1 cysteine hydrolase family protein -
  N7985_RS16185 (N7985_16185) yueI 3117049..3117447 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=635547 N7985_RS16155 WP_003220708.1 3112600..3112740(-) (degQ) [Bacillus subtilis strain SRCM116268]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=635547 N7985_RS16155 WP_003220708.1 3112600..3112740(-) (degQ) [Bacillus subtilis strain SRCM116268]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1