Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   N6G78_RS12215 Genome accession   NZ_CP104855
Coordinates   2377166..2377549 (-) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis strain TY-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2372166..2382549
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N6G78_RS12175 (N6G78_12175) sinI 2373101..2373274 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N6G78_RS12180 (N6G78_12180) sinR 2373308..2373643 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N6G78_RS12185 (N6G78_12185) tasA 2373736..2374521 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  N6G78_RS12190 (N6G78_12190) sipW 2374585..2375157 (-) 573 WP_080030740.1 signal peptidase I SipW -
  N6G78_RS12195 (N6G78_12195) tapA 2375141..2375902 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  N6G78_RS12200 (N6G78_12200) yqzG 2376172..2376498 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  N6G78_RS12205 (N6G78_12205) spoIITA 2376540..2376719 (-) 180 WP_003230176.1 YqzE family protein -
  N6G78_RS12210 (N6G78_12210) comGG 2376791..2377165 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  N6G78_RS12215 (N6G78_12215) comGF 2377166..2377549 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  N6G78_RS12220 (N6G78_12220) comGE 2377575..2377922 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  N6G78_RS12225 (N6G78_12225) comGD 2377906..2378337 (-) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  N6G78_RS12230 (N6G78_12230) comGC 2378327..2378623 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  N6G78_RS12235 (N6G78_12235) comGB 2378637..2379674 (-) 1038 WP_015483430.1 comG operon protein ComGB Machinery gene
  N6G78_RS12240 (N6G78_12240) comGA 2379661..2380731 (-) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  N6G78_RS12245 (N6G78_12245) corA 2381141..2382094 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=633796 N6G78_RS12215 WP_015384087.1 2377166..2377549(-) (comGF) [Bacillus subtilis strain TY-1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=633796 N6G78_RS12215 WP_015384087.1 2377166..2377549(-) (comGF) [Bacillus subtilis strain TY-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984