Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NP432_RS16040 Genome accession   NZ_CP101931
Coordinates   3110947..3111087 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BGSC b98af     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3105947..3116087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP432_RS16015 (NP432_16015) yuxO 3106289..3106669 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NP432_RS16020 (NP432_16020) comA 3106688..3107353 (-) 666 WP_256682951.1 two-component system response regulator ComA Regulator
  NP432_RS16025 (NP432_16025) comP 3107413..3109713 (-) 2301 WP_088300729.1 histidine kinase Regulator
  NP432_RS16030 (NP432_16030) comX 3109725..3109889 (-) 165 WP_015384519.1 competence pheromone ComX -
  NP432_RS16035 (NP432_16035) comQ 3109902..3110762 (-) 861 WP_064671628.1 polyprenyl synthetase family protein Regulator
  NP432_RS16040 (NP432_16040) degQ 3110947..3111087 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NP432_RS16045 (NP432_16045) - 3111309..3111434 (+) 126 WP_003228793.1 hypothetical protein -
  NP432_RS16050 (NP432_16050) - 3111548..3111916 (+) 369 WP_014477834.1 hypothetical protein -
  NP432_RS16055 (NP432_16055) pdeH 3111892..3113121 (-) 1230 WP_128738183.1 cyclic di-GMP phosphodiesterase -
  NP432_RS16060 (NP432_16060) pncB 3113258..3114730 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NP432_RS16065 (NP432_16065) pncA 3114746..3115297 (-) 552 WP_015714627.1 cysteine hydrolase family protein -
  NP432_RS16070 (NP432_16070) yueI 3115394..3115792 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=613085 NP432_RS16040 WP_003220708.1 3110947..3111087(-) (degQ) [Bacillus subtilis strain BGSC b98af]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=613085 NP432_RS16040 WP_003220708.1 3110947..3111087(-) (degQ) [Bacillus subtilis strain BGSC b98af]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1