Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NP433_RS16040 Genome accession   NZ_CP101930
Coordinates   3110946..3111086 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BGSC 10A5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3105946..3116086
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP433_RS16015 (NP433_16015) yuxO 3106288..3106668 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NP433_RS16020 (NP433_16020) comA 3106687..3107352 (-) 666 WP_256682951.1 two-component system response regulator ComA Regulator
  NP433_RS16025 (NP433_16025) comP 3107412..3109712 (-) 2301 WP_088300729.1 histidine kinase Regulator
  NP433_RS16030 (NP433_16030) comX 3109724..3109888 (-) 165 WP_015384519.1 competence pheromone ComX -
  NP433_RS16035 (NP433_16035) comQ 3109901..3110761 (-) 861 WP_064671628.1 polyprenyl synthetase family protein Regulator
  NP433_RS16040 (NP433_16040) degQ 3110946..3111086 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NP433_RS16045 (NP433_16045) - 3111308..3111433 (+) 126 WP_003228793.1 hypothetical protein -
  NP433_RS16050 (NP433_16050) - 3111547..3111915 (+) 369 WP_014477834.1 hypothetical protein -
  NP433_RS16055 (NP433_16055) pdeH 3111891..3113120 (-) 1230 WP_128738183.1 cyclic di-GMP phosphodiesterase -
  NP433_RS16060 (NP433_16060) pncB 3113257..3114729 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NP433_RS16065 (NP433_16065) pncA 3114745..3115296 (-) 552 WP_015714627.1 cysteine hydrolase family protein -
  NP433_RS16070 (NP433_16070) yueI 3115393..3115791 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=612936 NP433_RS16040 WP_003220708.1 3110946..3111086(-) (degQ) [Bacillus subtilis strain BGSC 10A5]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=612936 NP433_RS16040 WP_003220708.1 3110946..3111086(-) (degQ) [Bacillus subtilis strain BGSC 10A5]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1