Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG18_RS00720 Genome accession   NZ_CP094165
Coordinates   150541..150654 (+) Length   37 a.a.
NCBI ID   WP_073422943.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe0011     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 145541..155654
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG18_RS00695 (MPG18_00695) - 145603..147825 (+) 2223 WP_245078117.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG18_RS00700 (MPG18_00700) panD 147815..148165 (+) 351 WP_245078119.1 aspartate 1-decarboxylase -
  MPG18_RS00705 (MPG18_00705) - 148176..148469 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG18_RS00710 (MPG18_00710) - 148469..149464 (+) 996 WP_245078672.1 PDZ domain-containing protein -
  MPG18_RS00715 (MPG18_00715) comB6 149470..150525 (+) 1056 WP_245078674.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG18_RS00720 (MPG18_00720) comB7 150541..150654 (+) 114 WP_073422943.1 comB7 lipoprotein Machinery gene
  MPG18_RS00725 (MPG18_00725) comB8 150651..151394 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  MPG18_RS00730 (MPG18_00730) comB9 151394..152356 (+) 963 WP_245078121.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG18_RS00735 (MPG18_00735) comB10 152349..153485 (+) 1137 WP_245078122.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG18_RS00740 (MPG18_00740) - 153555..154958 (+) 1404 WP_245078124.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4287.23 Da        Isoelectric Point: 9.3572

>NTDB_id=576771 MPG18_RS00720 WP_073422943.1 150541..150654(+) (comB7) [Helicobacter pylori strain Hpfe0011]
MRIFFVIIGLILFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=576771 MPG18_RS00720 WP_073422943.1 150541..150654(+) (comB7) [Helicobacter pylori strain Hpfe0011]
ATGAGAATTTTTTTTGTTATTATTGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAATAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919