Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG35_RS00695 Genome accession   NZ_CP094138
Coordinates   150330..150455 (+) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe037     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 145330..155455
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG35_RS00670 (MPG35_00670) - 145393..147615 (+) 2223 WP_245019679.1 AAA family ATPase -
  MPG35_RS00675 (MPG35_00675) panD 147605..147955 (+) 351 WP_000142212.1 aspartate 1-decarboxylase -
  MPG35_RS00680 (MPG35_00680) - 147965..148258 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG35_RS00685 (MPG35_00685) - 148258..149253 (+) 996 WP_245019996.1 PDZ domain-containing protein -
  MPG35_RS00690 (MPG35_00690) comB6 149259..150314 (+) 1056 WP_245019997.1 type IV secretion system protein Machinery gene
  MPG35_RS00695 (MPG35_00695) comB7 150330..150455 (+) 126 WP_001217867.1 hypothetical protein Machinery gene
  MPG35_RS00700 (MPG35_00700) comB8 150452..151195 (+) 744 WP_000660533.1 virB8 family protein Machinery gene
  MPG35_RS00705 (MPG35_00705) comB9 151195..152157 (+) 963 WP_245019680.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG35_RS00710 (MPG35_00710) comB10 152150..153286 (+) 1137 WP_245019681.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG35_RS00715 (MPG35_00715) - 153356..154768 (+) 1413 WP_245019682.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=575997 MPG35_RS00695 WP_001217867.1 150330..150455(+) (comB7) [Helicobacter pylori strain Hpfe037]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575997 MPG35_RS00695 WP_001217867.1 150330..150455(+) (comB7) [Helicobacter pylori strain Hpfe037]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTGTTTGGTTGCACTAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829