Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG57_RS00730 Genome accession   NZ_CP094132
Coordinates   152863..152988 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe051     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 147863..157988
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG57_RS00705 (MPG57_00705) - 147923..150145 (+) 2223 WP_245081234.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG57_RS00710 (MPG57_00710) panD 150135..150485 (+) 351 WP_245081236.1 aspartate 1-decarboxylase -
  MPG57_RS00715 (MPG57_00715) - 150496..150789 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG57_RS00720 (MPG57_00720) - 150789..151784 (+) 996 WP_245081760.1 PDZ domain-containing protein -
  MPG57_RS00725 (MPG57_00725) comB6 151792..152847 (+) 1056 WP_245081238.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG57_RS00730 (MPG57_00730) comB7 152863..152988 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG57_RS00735 (MPG57_00735) comB8 152985..153728 (+) 744 WP_245081240.1 virB8 family protein Machinery gene
  MPG57_RS00740 (MPG57_00740) comB9 153728..154690 (+) 963 WP_245081242.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG57_RS00745 (MPG57_00745) comB10 154683..155819 (+) 1137 WP_245081243.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG57_RS00750 (MPG57_00750) - 155889..157301 (+) 1413 WP_245081245.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=575753 MPG57_RS00730 WP_001217874.1 152863..152988(+) (comB7) [Helicobacter pylori strain Hpfe051]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575753 MPG57_RS00730 WP_001217874.1 152863..152988(+) (comB7) [Helicobacter pylori strain Hpfe051]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878