Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPF99_RS02585 Genome accession   NZ_CP094130
Coordinates   525062..525187 (-) Length   41 a.a.
NCBI ID   WP_075668089.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe053     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 520062..530187
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF99_RS02565 (MPF99_02565) - 520749..522161 (-) 1413 WP_245059308.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  MPF99_RS02570 (MPF99_02570) comB10 522231..523367 (-) 1137 WP_245059310.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF99_RS02575 (MPF99_02575) comB9 523360..524322 (-) 963 WP_245059313.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF99_RS02580 (MPF99_02580) comB8 524322..525065 (-) 744 WP_245059315.1 virB8 family protein Machinery gene
  MPF99_RS02585 (MPF99_02585) comB7 525062..525187 (-) 126 WP_075668089.1 comB7 lipoprotein Machinery gene
  MPF99_RS02590 (MPF99_02590) comB6 525203..526258 (-) 1056 WP_245059317.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF99_RS02595 (MPF99_02595) - 526266..527261 (-) 996 WP_245059563.1 PDZ domain-containing protein -
  MPF99_RS02600 (MPF99_02600) - 527261..527554 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPF99_RS02605 (MPF99_02605) panD 527565..527915 (-) 351 WP_000142212.1 aspartate 1-decarboxylase -
  MPF99_RS02610 (MPF99_02610) - 527905..530127 (-) 2223 WP_245059319.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4738.72 Da        Isoelectric Point: 9.3278

>NTDB_id=575679 MPF99_RS02585 WP_075668089.1 525062..525187(-) (comB7) [Helicobacter pylori strain Hpfe053]
MRIFSVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575679 MPF99_RS02585 WP_075668089.1 525062..525187(-) (comB7) [Helicobacter pylori strain Hpfe053]
ATGAGAATTTTTTCTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854