Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG85_RS00725 Genome accession   NZ_CP094129
Coordinates   152422..152547 (+) Length   41 a.a.
NCBI ID   WP_245050847.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe054     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 147422..157547
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG85_RS00700 (MPG85_00700) - 147482..149704 (+) 2223 WP_245050841.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG85_RS00705 (MPG85_00705) panD 149694..150044 (+) 351 WP_245050843.1 aspartate 1-decarboxylase -
  MPG85_RS00710 (MPG85_00710) - 150055..150348 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG85_RS00715 (MPG85_00715) - 150348..151343 (+) 996 WP_245051473.1 PDZ domain-containing protein -
  MPG85_RS00720 (MPG85_00720) comB6 151351..152406 (+) 1056 WP_245050845.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG85_RS00725 (MPG85_00725) comB7 152422..152547 (+) 126 WP_245050847.1 comB7 lipoprotein Machinery gene
  MPG85_RS00730 (MPG85_00730) comB8 152544..153287 (+) 744 WP_245050849.1 virB8 family protein Machinery gene
  MPG85_RS00735 (MPG85_00735) comB9 153287..154252 (+) 966 WP_245050851.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG85_RS00740 (MPG85_00740) comB10 154245..155381 (+) 1137 WP_245050853.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG85_RS00745 (MPG85_00745) - 155447..156859 (+) 1413 WP_245050855.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4826.92 Da        Isoelectric Point: 9.9669

>NTDB_id=575633 MPG85_RS00725 WP_245050847.1 152422..152547(+) (comB7) [Helicobacter pylori strain Hpfe054]
MRIFFIIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLKLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575633 MPG85_RS00725 WP_245050847.1 152422..152547(+) (comB7) [Helicobacter pylori strain Hpfe054]
ATGAGAATTTTTTTTATTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAAATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAAACTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829