Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG79_RS00720 Genome accession   NZ_CP094128
Coordinates   155048..155173 (+) Length   41 a.a.
NCBI ID   WP_220877914.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe055     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 150048..160173
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG79_RS00695 (MPG79_00695) - 150108..152330 (+) 2223 WP_245107549.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG79_RS00700 (MPG79_00700) panD 152320..152670 (+) 351 WP_000142213.1 aspartate 1-decarboxylase -
  MPG79_RS00705 (MPG79_00705) - 152681..152974 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG79_RS00710 (MPG79_00710) - 152974..153969 (+) 996 WP_245107863.1 PDZ domain-containing protein -
  MPG79_RS00715 (MPG79_00715) comB6 153977..155032 (+) 1056 WP_245107864.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG79_RS00720 (MPG79_00720) comB7 155048..155173 (+) 126 WP_220877914.1 comB7 lipoprotein Machinery gene
  MPG79_RS00725 (MPG79_00725) comB8 155170..155907 (+) 738 WP_245107550.1 virB8 family protein Machinery gene
  MPG79_RS00730 (MPG79_00730) comB9 155907..156872 (+) 966 WP_245107551.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG79_RS00735 (MPG79_00735) comB10 156865..158001 (+) 1137 WP_245107552.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG79_RS00740 (MPG79_00740) - 158071..159483 (+) 1413 WP_245107553.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=575593 MPG79_RS00720 WP_220877914.1 155048..155173(+) (comB7) [Helicobacter pylori strain Hpfe055]
MRIFFVIMGLMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575593 MPG79_RS00720 WP_220877914.1 155048..155173(+) (comB7) [Helicobacter pylori strain Hpfe055]
ATGAGAATTTTTTTTGTCATTATGGGACTAATGTTGTTTGGTTGCACGAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854