Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG24_RS00700 Genome accession   NZ_CP094110
Coordinates   149654..149779 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe071     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 144654..154779
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG24_RS00675 (MPG24_00675) - 144713..146938 (+) 2226 WP_245104312.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG24_RS00680 (MPG24_00680) panD 146928..147278 (+) 351 WP_245104314.1 aspartate 1-decarboxylase -
  MPG24_RS00685 (MPG24_00685) - 147289..147582 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG24_RS00690 (MPG24_00690) - 147582..148577 (+) 996 WP_245104921.1 PDZ domain-containing protein -
  MPG24_RS00695 (MPG24_00695) comB6 148583..149638 (+) 1056 WP_245104923.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG24_RS00700 (MPG24_00700) comB7 149654..149779 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG24_RS00705 (MPG24_00705) comB8 149776..150519 (+) 744 WP_245104316.1 virB8 family protein Machinery gene
  MPG24_RS00710 (MPG24_00710) comB9 150519..151481 (+) 963 WP_245104318.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG24_RS00715 (MPG24_00715) comB10 151474..152610 (+) 1137 WP_245030629.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG24_RS00720 (MPG24_00720) - 152680..154092 (+) 1413 WP_245104320.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=575109 MPG24_RS00700 WP_001217874.1 149654..149779(+) (comB7) [Helicobacter pylori strain Hpfe071]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=575109 MPG24_RS00700 WP_001217874.1 149654..149779(+) (comB7) [Helicobacter pylori strain Hpfe071]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878