Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG65_RS00710 Genome accession   NZ_CP094105
Coordinates   153142..153267 (+) Length   41 a.a.
NCBI ID   WP_001217867.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe076     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 148142..158267
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG65_RS00685 (MPG65_00685) - 148202..150424 (+) 2223 WP_245072235.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG65_RS00690 (MPG65_00690) panD 150414..150764 (+) 351 WP_180446598.1 aspartate 1-decarboxylase -
  MPG65_RS00695 (MPG65_00695) - 150775..151068 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG65_RS00700 (MPG65_00700) - 151068..152063 (+) 996 WP_245072770.1 PDZ domain-containing protein -
  MPG65_RS00705 (MPG65_00705) comB6 152071..153126 (+) 1056 WP_154466563.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG65_RS00710 (MPG65_00710) comB7 153142..153267 (+) 126 WP_001217867.1 hypothetical protein Machinery gene
  MPG65_RS00715 (MPG65_00715) comB8 153264..154007 (+) 744 WP_245072236.1 virB8 family protein Machinery gene
  MPG65_RS00720 (MPG65_00720) comB9 154007..154969 (+) 963 WP_245072238.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG65_RS00725 (MPG65_00725) comB10 154962..156098 (+) 1137 WP_245072240.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG65_RS00730 (MPG65_00730) - 156168..157580 (+) 1413 WP_245072241.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4830.88 Da        Isoelectric Point: 9.3278

>NTDB_id=574945 MPG65_RS00710 WP_001217867.1 153142..153267(+) (comB7) [Helicobacter pylori strain Hpfe076]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574945 MPG65_RS00710 WP_001217867.1 153142..153267(+) (comB7) [Helicobacter pylori strain Hpfe076]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829