Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG76_RS00700 Genome accession   NZ_CP094098
Coordinates   148972..149097 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe081     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 143972..154097
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG76_RS00675 (MPG76_00675) - 144034..146256 (+) 2223 WP_245038524.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG76_RS00680 (MPG76_00680) panD 146246..146596 (+) 351 WP_245038525.1 aspartate 1-decarboxylase -
  MPG76_RS00685 (MPG76_00685) - 146607..146900 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG76_RS00690 (MPG76_00690) - 146900..147895 (+) 996 WP_245039231.1 PDZ domain-containing protein -
  MPG76_RS00695 (MPG76_00695) comB6 147901..148956 (+) 1056 WP_245039232.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG76_RS00700 (MPG76_00700) comB7 148972..149097 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG76_RS00705 (MPG76_00705) comB8 149094..149837 (+) 744 WP_245038526.1 virB8 family protein Machinery gene
  MPG76_RS00710 (MPG76_00710) comB9 149837..150799 (+) 963 WP_245038527.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG76_RS00715 (MPG76_00715) comB10 150792..151928 (+) 1137 WP_245038528.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG76_RS00720 (MPG76_00720) - 151998..153410 (+) 1413 WP_245038529.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=574786 MPG76_RS00700 WP_001217874.1 148972..149097(+) (comB7) [Helicobacter pylori strain Hpfe081]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574786 MPG76_RS00700 WP_001217874.1 148972..149097(+) (comB7) [Helicobacter pylori strain Hpfe081]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878