Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG55_RS00770 Genome accession   NZ_CP094083
Coordinates   159255..159380 (+) Length   41 a.a.
NCBI ID   WP_231172561.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe096     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 154255..164380
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG55_RS00745 (MPG55_00745) - 154318..156537 (+) 2220 WP_245028761.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG55_RS00750 (MPG55_00750) panD 156527..156877 (+) 351 WP_000142213.1 aspartate 1-decarboxylase -
  MPG55_RS00755 (MPG55_00755) - 156888..157181 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPG55_RS00760 (MPG55_00760) - 157181..158176 (+) 996 WP_245028763.1 PDZ domain-containing protein -
  MPG55_RS00765 (MPG55_00765) comB6 158184..159239 (+) 1056 WP_245028765.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG55_RS00770 (MPG55_00770) comB7 159255..159380 (+) 126 WP_231172561.1 comB7 lipoprotein Machinery gene
  MPG55_RS00775 (MPG55_00775) comB8 159377..160120 (+) 744 WP_245028767.1 virB8 family protein Machinery gene
  MPG55_RS00780 (MPG55_00780) comB9 160120..161085 (+) 966 WP_245028769.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG55_RS00785 (MPG55_00785) comB10 161078..162214 (+) 1137 WP_245028772.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG55_RS00790 (MPG55_00790) - 162284..163696 (+) 1413 WP_245028774.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4734.72 Da        Isoelectric Point: 9.3278

>NTDB_id=574346 MPG55_RS00770 WP_231172561.1 159255..159380(+) (comB7) [Helicobacter pylori strain Hpfe096]
MRIFSVIMGLILFGCTSKVHEIKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574346 MPG55_RS00770 WP_231172561.1 159255..159380(+) (comB7) [Helicobacter pylori strain Hpfe096]
ATGAGAATTTTTTCTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATAAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

80.488

100

0.805