Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG56_RS00715 Genome accession   NZ_CP094076
Coordinates   148935..149060 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe102     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 143935..154060
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG56_RS00690 (MPG56_00690) - 143997..146219 (+) 2223 WP_245043834.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG56_RS00695 (MPG56_00695) panD 146209..146559 (+) 351 WP_245043836.1 aspartate 1-decarboxylase -
  MPG56_RS00700 (MPG56_00700) - 146570..146863 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPG56_RS00705 (MPG56_00705) - 146863..147858 (+) 996 WP_245044427.1 PDZ domain-containing protein -
  MPG56_RS00710 (MPG56_00710) comB6 147864..148919 (+) 1056 WP_245044429.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG56_RS00715 (MPG56_00715) comB7 148935..149060 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG56_RS00720 (MPG56_00720) comB8 149057..149800 (+) 744 WP_000660545.1 virB8 family protein Machinery gene
  MPG56_RS00725 (MPG56_00725) comB9 149800..150762 (+) 963 WP_245043838.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG56_RS00730 (MPG56_00730) comB10 150755..151891 (+) 1137 WP_245043840.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG56_RS00735 (MPG56_00735) - 151961..153373 (+) 1413 WP_245043842.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=574140 MPG56_RS00715 WP_001217874.1 148935..149060(+) (comB7) [Helicobacter pylori strain Hpfe102]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=574140 MPG56_RS00715 WP_001217874.1 148935..149060(+) (comB7) [Helicobacter pylori strain Hpfe102]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878