Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG66_RS00715 Genome accession   NZ_CP094056
Coordinates   152345..152470 (+) Length   41 a.a.
NCBI ID   WP_120902658.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe124     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 147345..157470
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG66_RS00690 (MPG66_00690) - 147405..149627 (+) 2223 WP_245025075.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG66_RS00695 (MPG66_00695) panD 149617..149967 (+) 351 WP_000142213.1 aspartate 1-decarboxylase -
  MPG66_RS00700 (MPG66_00700) - 149978..150271 (+) 294 WP_060870524.1 YbaB/EbfC family nucleoid-associated protein -
  MPG66_RS00705 (MPG66_00705) - 150271..151266 (+) 996 WP_245025765.1 PDZ domain-containing protein -
  MPG66_RS00710 (MPG66_00710) comB6 151274..152329 (+) 1056 WP_154466563.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG66_RS00715 (MPG66_00715) comB7 152345..152470 (+) 126 WP_120902658.1 comB7 lipoprotein Machinery gene
  MPG66_RS00720 (MPG66_00720) comB8 152467..153204 (+) 738 WP_245025077.1 virB8 family protein Machinery gene
  MPG66_RS00725 (MPG66_00725) comB9 153204..154166 (+) 963 WP_245025079.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG66_RS00730 (MPG66_00730) comB10 154159..155295 (+) 1137 WP_245025081.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG66_RS00735 (MPG66_00735) - 155361..156773 (+) 1413 WP_245025083.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4812.85 Da        Isoelectric Point: 9.3278

>NTDB_id=573569 MPG66_RS00715 WP_120902658.1 152345..152470(+) (comB7) [Helicobacter pylori strain Hpfe124]
MRIFFVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=573569 MPG66_RS00715 WP_120902658.1 152345..152470(+) (comB7) [Helicobacter pylori strain Hpfe124]
ATGAGAATTTTTTTTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAATTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854