Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | J7S31_RS05195 | Genome accession | NZ_CP072523 |
| Coordinates | 1056963..1057145 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes strain SHZ-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1056963..1096794 | 1056963..1057145 | within | 0 |
Gene organization within MGE regions
Location: 1056963..1096794
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J7S31_RS05195 (J7S31_05185) | prx | 1056963..1057145 (-) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
| J7S31_RS05200 (J7S31_05190) | - | 1057212..1058006 (-) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| J7S31_RS05205 (J7S31_05195) | - | 1058251..1059465 (-) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| J7S31_RS05210 (J7S31_05200) | - | 1059577..1060032 (-) | 456 | WP_002983475.1 | phage holin family protein | - |
| J7S31_RS05215 (J7S31_05205) | - | 1060043..1060657 (-) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| J7S31_RS05220 (J7S31_05210) | - | 1060660..1061091 (-) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| J7S31_RS05225 (J7S31_05215) | - | 1061100..1062881 (-) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| J7S31_RS05230 (J7S31_05220) | - | 1062896..1064005 (-) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| J7S31_RS05235 (J7S31_05225) | - | 1064005..1065978 (-) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| J7S31_RS05240 (J7S31_05230) | - | 1065960..1066655 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| J7S31_RS05245 (J7S31_05235) | - | 1066652..1069015 (-) | 2364 | WP_011054677.1 | hypothetical protein | - |
| J7S31_RS05250 (J7S31_05240) | - | 1069015..1069386 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| J7S31_RS05255 (J7S31_05245) | - | 1069401..1069664 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| J7S31_RS05260 (J7S31_05250) | - | 1069675..1070265 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| J7S31_RS05265 (J7S31_05255) | - | 1070281..1070616 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| J7S31_RS05270 (J7S31_05260) | - | 1070617..1070853 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| J7S31_RS05275 (J7S31_05265) | - | 1070846..1071184 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| J7S31_RS05280 (J7S31_05270) | - | 1071144..1071566 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| J7S31_RS05285 (J7S31_05275) | - | 1071576..1071776 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| J7S31_RS05290 (J7S31_05280) | - | 1071776..1072687 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| J7S31_RS05295 (J7S31_05285) | - | 1072712..1073173 (-) | 462 | WP_011054684.1 | DUF4355 domain-containing protein | - |
| J7S31_RS05300 (J7S31_05290) | - | 1073254..1074669 (-) | 1416 | WP_011054685.1 | terminase | - |
| J7S31_RS05305 (J7S31_05295) | - | 1074751..1074966 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| J7S31_RS05310 (J7S31_05300) | - | 1074968..1075234 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| J7S31_RS05315 (J7S31_05305) | - | 1075227..1075379 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| J7S31_RS05320 (J7S31_05310) | - | 1075456..1075680 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| J7S31_RS05325 (J7S31_05315) | - | 1075686..1077179 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| J7S31_RS05330 (J7S31_05320) | - | 1077172..1078440 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| J7S31_RS05335 (J7S31_05325) | - | 1078437..1078793 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| J7S31_RS05340 (J7S31_05330) | - | 1078941..1079285 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| J7S31_RS05345 (J7S31_05335) | - | 1079393..1079812 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| J7S31_RS05350 (J7S31_05340) | - | 1079888..1080139 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| J7S31_RS05355 (J7S31_05345) | - | 1080136..1080291 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| J7S31_RS05360 (J7S31_05350) | - | 1080288..1080605 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| J7S31_RS05365 (J7S31_05355) | - | 1080641..1081153 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| J7S31_RS05370 (J7S31_05360) | - | 1081150..1081482 (-) | 333 | WP_011054696.1 | hypothetical protein | - |
| J7S31_RS05375 (J7S31_05365) | - | 1081493..1082839 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| J7S31_RS05380 (J7S31_05370) | - | 1082836..1083231 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| J7S31_RS05385 (J7S31_05375) | - | 1083596..1084393 (-) | 798 | WP_240788762.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| J7S31_RS05390 (J7S31_05380) | - | 1084386..1084586 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| J7S31_RS05395 (J7S31_05385) | - | 1084583..1085509 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| J7S31_RS05400 (J7S31_05390) | - | 1085512..1085842 (-) | 331 | Protein_1021 | hypothetical protein | - |
| J7S31_RS05405 (J7S31_05395) | - | 1085898..1086104 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| J7S31_RS05410 (J7S31_05400) | - | 1086113..1086253 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| J7S31_RS05415 (J7S31_05405) | - | 1086250..1086483 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| J7S31_RS05420 (J7S31_05410) | - | 1086464..1086850 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| J7S31_RS05425 | - | 1086991..1087260 (-) | 270 | WP_011106700.1 | replication protein | - |
| J7S31_RS05430 (J7S31_05415) | - | 1087354..1087539 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| J7S31_RS05435 (J7S31_05420) | - | 1087541..1087852 (-) | 312 | WP_010922478.1 | excisionase | - |
| J7S31_RS05440 (J7S31_05425) | - | 1088122..1088334 (-) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| J7S31_RS05445 (J7S31_05430) | - | 1088536..1089291 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| J7S31_RS05450 (J7S31_05435) | - | 1089303..1089821 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| J7S31_RS05455 (J7S31_05440) | - | 1089945..1091087 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| J7S31_RS05460 (J7S31_05445) | - | 1091176..1091451 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| J7S31_RS05465 (J7S31_05450) | - | 1091550..1092137 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| J7S31_RS05470 (J7S31_05455) | - | 1092115..1092957 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| J7S31_RS05475 (J7S31_05460) | - | 1092950..1093789 (-) | 840 | WP_011054703.1 | DegV family protein | - |
| J7S31_RS05480 (J7S31_05465) | - | 1094017..1094961 (-) | 945 | WP_011054704.1 | LPXTG cell wall anchor domain-containing protein | - |
| J7S31_RS05485 (J7S31_05470) | recN | 1095133..1096794 (-) | 1662 | WP_002983909.1 | DNA repair protein RecN | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=553868 J7S31_RS05195 WP_011054671.1 1056963..1057145(-) (prx) [Streptococcus pyogenes strain SHZ-1]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=553868 J7S31_RS05195 WP_011054671.1 1056963..1057145(-) (prx) [Streptococcus pyogenes strain SHZ-1]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |