Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LRP64_RS07465 | Genome accession | NZ_CP088158 |
| Coordinates | 1576785..1577096 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain 697 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1571785..1582096
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRP64_RS07430 (LRP64_07430) | gcvPA | 1572287..1573633 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| LRP64_RS07435 (LRP64_07435) | gcvT | 1573653..1574744 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LRP64_RS07440 (LRP64_07440) | - | 1574903..1575427 (-) | 525 | WP_001015116.1 | shikimate kinase | - |
| LRP64_RS07445 (LRP64_07445) | - | 1575417..1575563 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| LRP64_RS07450 (LRP64_07450) | comGF | 1575660..1576157 (-) | 498 | WP_001838632.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LRP64_RS07455 (LRP64_07455) | comGE | 1576075..1576374 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| LRP64_RS07460 (LRP64_07460) | comGD | 1576361..1576807 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LRP64_RS07465 (LRP64_07465) | comGC | 1576785..1577096 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LRP64_RS07470 (LRP64_07470) | comGB | 1577110..1578180 (-) | 1071 | WP_000776407.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LRP64_RS07475 (LRP64_07475) | comGA | 1578152..1579126 (-) | 975 | WP_000697218.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LRP64_RS07480 (LRP64_07480) | - | 1579178..1579801 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| LRP64_RS07485 (LRP64_07485) | - | 1579798..1580127 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| LRP64_RS07490 (LRP64_07490) | - | 1580127..1581113 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| LRP64_RS07495 (LRP64_07495) | - | 1581110..1581313 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=547485 LRP64_RS07465 WP_000472256.1 1576785..1577096(-) (comGC) [Staphylococcus aureus strain 697]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=547485 LRP64_RS07465 WP_000472256.1 1576785..1577096(-) (comGC) [Staphylococcus aureus strain 697]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |