Detailed information NTG0544839

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: JZY07_RS00760
• Genome accession: NZ_CP071305
• Coordinates: 123571..123852 (+)
• Length: 93 a.a.
• NCBI ID: WP_024387069.1
• Uniprot ID: A0A0Z8MAK5
• Organism: Streptococcus suis strain SC183
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 118571..128852

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JZY07_RS00740 (JZY07_00740)	-	120232..120606 (+)	375	WP_024412237.1	DUF1033 family protein	-
JZY07_RS00745 (JZY07_00745)	-	120634..121584 (-)	951	WP_024412238.1	S66 peptidase family protein	-
JZY07_RS00750 (JZY07_00750)	comYA	121670..122620 (+)	951	WP_024412239.1	competence type IV pilus ATPase ComGA	Machinery gene
JZY07_RS00755 (JZY07_00755)	comYB	122532..123569 (+)	1038	WP_050571918.1	competence type IV pilus assembly protein ComGB	Machinery gene
JZY07_RS00760 (JZY07_00760)	comYC	123571..123852 (+)	282	WP_024387069.1	competence type IV pilus major pilin ComGC	Machinery gene
JZY07_RS00765 (JZY07_00765)	comGD	123833..124240 (+)	408	WP_024387070.1	competence type IV pilus minor pilin ComGD	-
JZY07_RS00770 (JZY07_00770)	comYE	124212..124505 (+)	294	WP_011921722.1	competence type IV pilus minor pilin ComGE	Machinery gene
JZY07_RS00775 (JZY07_00775)	comGF/cglF	124492..124926 (+)	435	WP_079268055.1	competence type IV pilus minor pilin ComGF	Machinery gene
JZY07_RS00780 (JZY07_00780)	comGG	124904..125431 (+)	528	WP_024399584.1	competence type IV pilus minor pilin ComGG	-
JZY07_RS00785 (JZY07_00785)	-	125577..126440 (+)	864	WP_105141859.1	IS982 family transposase	-
JZY07_RS00790 (JZY07_00790)	-	126685..126852 (-)	168	WP_171992300.1	hypothetical protein	-
JZY07_RS11475	-	126896..127156 (-)	261	WP_228380968.1	hypothetical protein	-
JZY07_RS11480	-	127348..127563 (-)	216	WP_228380969.1	hypothetical protein	-
JZY07_RS11485	-	127612..127809 (-)	198	WP_228380148.1	hypothetical protein	-
JZY07_RS00805 (JZY07_00805)	-	127806..128645 (-)	840	WP_024399985.1	ATP-binding protein	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10350.30 Da
• Isoelectric Point: 8.4284

>NTDB_id=544839 JZY07_RS00760 WP_024387069.1 123571..123852(+) (comYC) [Streptococcus suis strain SC183]
MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKKGDAAVVKVVESQMELYELEHDKEATVADLQAAGYI
TEKQAKQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=544839 JZY07_RS00760 WP_024387069.1 123571..123852(+) (comYC) [Streptococcus suis strain SC183]
ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCT
CTTGCTCCTTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCGGCTGTTGTCAAAGTAG
TGGAGAGCCAGATGGAGCTCTATGAATTGGAACATGACAAGGAAGCAACGGTGGCAGACTTGCAGGCAGCTGGCTACATC
ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0Z8MAK5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	97.849	100	0.978
comGC/cglC	Streptococcus mitis NCTC 12261	67.059	91.398	0.613
comGC/cglC	Streptococcus mitis SK321	67.059	91.398	0.613
comGC/cglC	Streptococcus pneumoniae D39	69.136	87.097	0.602
comGC/cglC	Streptococcus pneumoniae R6	69.136	87.097	0.602
comGC/cglC	Streptococcus pneumoniae TIGR4	69.136	87.097	0.602
comGC/cglC	Streptococcus pneumoniae Rx1	69.136	87.097	0.602
comYC	Streptococcus gordonii str. Challis substr. CH1	62.921	95.699	0.602
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	57.955	94.624	0.548
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398