Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | JRY11_RS05980 | Genome accession | NZ_CP070382 |
| Coordinates | 1109098..1109550 (+) | Length | 150 a.a. |
| NCBI ID | WP_023189115.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain KF140 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1097241..1149894 | 1109098..1109550 | within | 0 |
Gene organization within MGE regions
Location: 1097241..1149894
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JRY11_RS05875 (JRY11_001183) | - | 1097241..1097615 (+) | 375 | WP_025017158.1 | nuclear transport factor 2 family protein | - |
| JRY11_RS05880 (JRY11_001184) | - | 1097628..1098149 (+) | 522 | WP_248554426.1 | NUDIX hydrolase | - |
| JRY11_RS05885 (JRY11_001185) | - | 1098115..1098579 (+) | 465 | WP_003131474.1 | VOC family protein | - |
| JRY11_RS05890 (JRY11_001186) | fmt | 1098576..1099535 (+) | 960 | WP_023189127.1 | methionyl-tRNA formyltransferase | - |
| JRY11_RS05895 (JRY11_001187) | - | 1099710..1099952 (+) | 243 | WP_003131476.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| JRY11_RS05900 (JRY11_001188) | amaP | 1099980..1100540 (+) | 561 | WP_010906186.1 | alkaline shock response membrane anchor protein AmaP | - |
| JRY11_RS05905 (JRY11_001189) | - | 1100551..1100739 (+) | 189 | WP_012898445.1 | DUF2273 domain-containing protein | - |
| JRY11_RS05910 (JRY11_001190) | - | 1100760..1101266 (+) | 507 | WP_012898444.1 | Asp23/Gls24 family envelope stress response protein | - |
| JRY11_RS05915 (JRY11_001191) | - | 1101567..1102748 (-) | 1182 | WP_023189126.1 | site-specific integrase | - |
| JRY11_RS05920 (JRY11_001192) | - | 1102816..1103151 (-) | 336 | WP_023189125.1 | hypothetical protein | - |
| JRY11_RS05925 (JRY11_001193) | - | 1103165..1103599 (-) | 435 | WP_023189124.1 | hypothetical protein | - |
| JRY11_RS05930 (JRY11_001194) | - | 1103605..1104171 (-) | 567 | WP_025017155.1 | helix-turn-helix domain-containing protein | - |
| JRY11_RS05935 (JRY11_001195) | - | 1104718..1105326 (-) | 609 | WP_248554427.1 | hypothetical protein | - |
| JRY11_RS05940 (JRY11_001196) | - | 1105481..1105705 (+) | 225 | WP_002819833.1 | DUF739 family protein | - |
| JRY11_RS05945 (JRY11_001197) | - | 1105733..1106500 (+) | 768 | WP_023189121.1 | phage antirepressor KilAC domain-containing protein | - |
| JRY11_RS05950 (JRY11_001198) | - | 1106513..1106782 (+) | 270 | WP_014570757.1 | hypothetical protein | - |
| JRY11_RS05955 (JRY11_001199) | - | 1106875..1107258 (+) | 384 | WP_023189120.1 | hypothetical protein | - |
| JRY11_RS05960 (JRY11_001200) | - | 1107251..1107628 (-) | 378 | WP_025017153.1 | DUF2513 domain-containing protein | - |
| JRY11_RS05965 (JRY11_001201) | - | 1107736..1107978 (+) | 243 | WP_023189118.1 | hypothetical protein | - |
| JRY11_RS05970 (JRY11_001202) | - | 1108077..1108466 (+) | 390 | WP_023189117.1 | hypothetical protein | - |
| JRY11_RS05975 (JRY11_001203) | - | 1108475..1109098 (+) | 624 | WP_023189116.1 | DUF1071 domain-containing protein | - |
| JRY11_RS05980 (JRY11_001204) | ssb | 1109098..1109550 (+) | 453 | WP_023189115.1 | single-stranded DNA-binding protein | Machinery gene |
| JRY11_RS05985 (JRY11_001205) | - | 1109675..1110457 (+) | 783 | WP_023189114.1 | phage replisome organiser protein | - |
| JRY11_RS05990 (JRY11_001206) | - | 1110457..1111182 (+) | 726 | WP_023189113.1 | hypothetical protein | - |
| JRY11_RS05995 (JRY11_001207) | - | 1111179..1111553 (+) | 375 | WP_023189112.1 | DUF1064 domain-containing protein | - |
| JRY11_RS06000 (JRY11_001208) | - | 1111556..1111795 (+) | 240 | WP_025017150.1 | DUF1031 family protein | - |
| JRY11_RS06005 (JRY11_001209) | - | 1111906..1112070 (+) | 165 | WP_010905354.1 | hypothetical protein | - |
| JRY11_RS06010 (JRY11_001210) | - | 1112045..1112407 (+) | 363 | WP_023189110.1 | DUF658 family protein | - |
| JRY11_RS06015 (JRY11_001211) | - | 1112418..1112807 (+) | 390 | WP_023189109.1 | YopX family protein | - |
| JRY11_RS06020 (JRY11_001212) | - | 1112936..1113142 (+) | 207 | WP_023189108.1 | DUF1125 domain-containing protein | - |
| JRY11_RS06025 (JRY11_001213) | - | 1113135..1113626 (+) | 492 | WP_023189107.1 | DUF1642 domain-containing protein | - |
| JRY11_RS06030 (JRY11_001214) | - | 1113623..1113934 (+) | 312 | WP_023189106.1 | hypothetical protein | - |
| JRY11_RS06035 (JRY11_001215) | dut | 1113931..1114350 (+) | 420 | WP_248554428.1 | dUTP diphosphatase | - |
| JRY11_RS06040 (JRY11_001216) | - | 1114369..1114899 (+) | 531 | WP_023189104.1 | HNH endonuclease | - |
| JRY11_RS06045 (JRY11_001217) | - | 1114902..1115186 (+) | 285 | WP_023189103.1 | hypothetical protein | - |
| JRY11_RS06050 (JRY11_001218) | - | 1115255..1115419 (+) | 165 | WP_010905361.1 | hypothetical protein | - |
| JRY11_RS06055 (JRY11_001219) | - | 1115466..1115708 (+) | 243 | WP_044009686.1 | hypothetical protein | - |
| JRY11_RS06060 (JRY11_001220) | - | 1115705..1115950 (+) | 246 | WP_032944896.1 | DUF1660 domain-containing protein | - |
| JRY11_RS06065 (JRY11_001221) | - | 1116002..1116211 (-) | 210 | WP_021722221.1 | hypothetical protein | - |
| JRY11_RS06070 (JRY11_001222) | - | 1117001..1117654 (+) | 654 | WP_025017186.1 | SPFH domain-containing protein | - |
| JRY11_RS06075 (JRY11_001223) | - | 1117731..1118030 (+) | 300 | WP_023189100.1 | hypothetical protein | - |
| JRY11_RS06080 | - | 1118079..1118378 (+) | 300 | WP_031560811.1 | HNH endonuclease | - |
| JRY11_RS06085 (JRY11_001224) | - | 1118520..1118831 (+) | 312 | WP_023189099.1 | P27 family phage terminase small subunit | - |
| JRY11_RS06090 (JRY11_001225) | - | 1118821..1120560 (+) | 1740 | WP_023189098.1 | terminase TerL endonuclease subunit | - |
| JRY11_RS06095 (JRY11_001226) | - | 1120641..1121270 (+) | 630 | WP_023189097.1 | hypothetical protein | - |
| JRY11_RS06100 (JRY11_001228) | - | 1121529..1122722 (+) | 1194 | WP_025017184.1 | phage portal protein | - |
| JRY11_RS06105 (JRY11_001229) | - | 1122709..1123476 (+) | 768 | WP_163688067.1 | head maturation protease, ClpP-related | - |
| JRY11_RS06110 (JRY11_001230) | - | 1123476..1124597 (+) | 1122 | WP_248554429.1 | phage major capsid protein | - |
| JRY11_RS06115 (JRY11_001231) | - | 1124646..1124978 (+) | 333 | WP_023189093.1 | hypothetical protein | - |
| JRY11_RS06120 (JRY11_001232) | - | 1124944..1125330 (+) | 387 | WP_025017183.1 | hypothetical protein | - |
| JRY11_RS06125 (JRY11_001233) | - | 1125323..1125727 (+) | 405 | WP_023189091.1 | HK97 gp10 family phage protein | - |
| JRY11_RS06130 (JRY11_001234) | - | 1125724..1126113 (+) | 390 | WP_023189090.1 | hypothetical protein | - |
| JRY11_RS06135 (JRY11_001235) | - | 1126061..1126717 (+) | 657 | WP_196229674.1 | major tail protein | - |
| JRY11_RS06140 (JRY11_001236) | - | 1126723..1127061 (+) | 339 | WP_248554430.1 | hypothetical protein | - |
| JRY11_RS06145 (JRY11_001237) | - | 1127036..1127248 (+) | 213 | WP_023189087.1 | hypothetical protein | - |
| JRY11_RS06150 (JRY11_001238) | - | 1127320..1127751 (+) | 432 | WP_032944888.1 | hypothetical protein | - |
| JRY11_RS06155 | - | 1127787..1127882 (+) | 96 | WP_230494261.1 | hypothetical protein | - |
| JRY11_RS06160 (JRY11_001239) | - | 1127960..1132012 (+) | 4053 | WP_052484085.1 | phage tail tape measure protein | - |
| JRY11_RS06165 (JRY11_001240) | - | 1132009..1133535 (+) | 1527 | WP_248554431.1 | distal tail protein Dit | - |
| JRY11_RS06170 (JRY11_001241) | - | 1133535..1135322 (+) | 1788 | WP_044009714.1 | phage tail spike protein | - |
| JRY11_RS06175 (JRY11_001242) | - | 1135339..1136460 (+) | 1122 | WP_023189745.1 | hypothetical protein | - |
| JRY11_RS06180 (JRY11_001243) | - | 1136460..1136633 (+) | 174 | WP_023189746.1 | hypothetical protein | - |
| JRY11_RS06185 (JRY11_001245) | - | 1137166..1138389 (+) | 1224 | WP_155384503.1 | hypothetical protein | - |
| JRY11_RS06190 (JRY11_001246) | - | 1138400..1138636 (+) | 237 | WP_023189749.1 | hypothetical protein | - |
| JRY11_RS06195 (JRY11_001247) | - | 1138649..1138873 (+) | 225 | WP_023189750.1 | hemolysin XhlA family protein | - |
| JRY11_RS06200 (JRY11_001248) | - | 1138886..1139173 (+) | 288 | WP_010905390.1 | phage holin | - |
| JRY11_RS06205 (JRY11_001249) | - | 1139173..1139952 (+) | 780 | WP_058222357.1 | peptidoglycan amidohydrolase family protein | - |
| JRY11_RS06215 (JRY11_001250) | rsmB | 1140907..1142181 (+) | 1275 | WP_014570715.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| JRY11_RS06220 (JRY11_001251) | - | 1142262..1143038 (+) | 777 | WP_023189752.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| JRY11_RS06225 (JRY11_001252) | pknB | 1143038..1144921 (+) | 1884 | WP_058207874.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| JRY11_RS06230 (JRY11_001253) | rpsO | 1145103..1145372 (+) | 270 | WP_010906184.1 | 30S ribosomal protein S15 | - |
| JRY11_RS06235 (JRY11_001254) | proC | 1145403..1146191 (-) | 789 | WP_012898440.1 | pyrroline-5-carboxylate reductase | - |
| JRY11_RS06240 (JRY11_001255) | glmU | 1146419..1147795 (+) | 1377 | WP_023189754.1 | bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU | - |
| JRY11_RS06245 (JRY11_001256) | - | 1147900..1148484 (+) | 585 | WP_012898439.1 | NUDIX hydrolase | - |
| JRY11_RS06250 (JRY11_001257) | macP | 1148477..1148755 (+) | 279 | WP_003130796.1 | cell wall synthase accessory phosphoprotein MacP | - |
| JRY11_RS06255 (JRY11_001258) | - | 1148788..1149468 (+) | 681 | WP_023189755.1 | 5'-methylthioadenosine/adenosylhomocysteine nucleosidase | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16698.79 Da Isoelectric Point: 9.5055
>NTDB_id=539604 JRY11_RS05980 WP_023189115.1 1109098..1109550(+) (ssb) [Lactococcus lactis strain KF140]
MINNVVLVGRLTRDPELRYTPQNQAVGTFGLAVNRQFKNANGEREADFINCVIWRQQAENLAKFAKKGALIGITGRIQTR
NYENQQGQKVYVTEVVADTFQMLESNKTQGQQTSKPQAQNKKLQAPDPFKAPAADPFAGGTEISDDQLPF
MINNVVLVGRLTRDPELRYTPQNQAVGTFGLAVNRQFKNANGEREADFINCVIWRQQAENLAKFAKKGALIGITGRIQTR
NYENQQGQKVYVTEVVADTFQMLESNKTQGQQTSKPQAQNKKLQAPDPFKAPAADPFAGGTEISDDQLPF
Nucleotide
Download Length: 453 bp
>NTDB_id=539604 JRY11_RS05980 WP_023189115.1 1109098..1109550(+) (ssb) [Lactococcus lactis strain KF140]
ATGATTAACAACGTTGTATTAGTAGGTCGCTTAACTCGTGACCCTGAACTTAGATATACACCACAGAACCAAGCAGTAGG
CACATTTGGATTAGCTGTAAATCGTCAGTTTAAGAACGCCAATGGAGAGCGAGAAGCTGACTTCATTAATTGTGTTATTT
GGCGACAACAAGCCGAAAATTTAGCCAAATTTGCTAAAAAAGGCGCTTTGATTGGAATAACTGGACGAATTCAAACACGA
AACTATGAGAACCAACAAGGACAAAAAGTTTATGTGACTGAAGTTGTTGCAGATACTTTCCAAATGCTAGAAAGCAATAA
AACACAAGGTCAGCAAACAAGTAAACCGCAAGCTCAAAATAAAAAGCTACAAGCACCAGATCCTTTTAAAGCTCCTGCTG
CTGATCCATTTGCTGGTGGTACTGAAATTTCAGACGACCAACTACCATTTTAA
ATGATTAACAACGTTGTATTAGTAGGTCGCTTAACTCGTGACCCTGAACTTAGATATACACCACAGAACCAAGCAGTAGG
CACATTTGGATTAGCTGTAAATCGTCAGTTTAAGAACGCCAATGGAGAGCGAGAAGCTGACTTCATTAATTGTGTTATTT
GGCGACAACAAGCCGAAAATTTAGCCAAATTTGCTAAAAAAGGCGCTTTGATTGGAATAACTGGACGAATTCAAACACGA
AACTATGAGAACCAACAAGGACAAAAAGTTTATGTGACTGAAGTTGTTGCAGATACTTTCCAAATGCTAGAAAGCAATAA
AACACAAGGTCAGCAAACAAGTAAACCGCAAGCTCAAAATAAAAAGCTACAAGCACCAGATCCTTTTAAAGCTCCTGCTG
CTGATCCATTTGCTGGTGGTACTGAAATTTCAGACGACCAACTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.235 |
100 |
0.66 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.607 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.615 |
69.333 |
0.413 |
| ssb | Neisseria gonorrhoeae MS11 |
33.721 |
100 |
0.387 |
| ssb | Neisseria meningitidis MC58 |
33.721 |
100 |
0.387 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
52.381 |
70 |
0.367 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
51.429 |
70 |
0.36 |