Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JR441_RS16115 Genome accession   NZ_CP069789
Coordinates   3123677..3123817 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BIM B-569G     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3118677..3128817
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JR441_RS16090 (JR441_16090) yuxO 3118982..3119362 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  JR441_RS16095 (JR441_16095) comA 3119381..3120025 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  JR441_RS16100 (JR441_16100) - 3120106..3122390 (-) 2285 Protein_3132 histidine kinase -
  JR441_RS16105 (JR441_16105) comX 3122406..3122627 (-) 222 WP_014480704.1 competence pheromone ComX -
  JR441_RS16110 (JR441_16110) - 3122629..3123492 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  JR441_RS16115 (JR441_16115) degQ 3123677..3123817 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  JR441_RS16120 (JR441_16120) - 3124039..3124164 (+) 126 WP_121549029.1 hypothetical protein -
  JR441_RS16125 (JR441_16125) - 3124279..3124647 (+) 369 WP_038427878.1 hypothetical protein -
  JR441_RS16130 (JR441_16130) pdeH 3124623..3125852 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  JR441_RS16135 (JR441_16135) pncB 3125989..3127461 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  JR441_RS16140 (JR441_16140) pncA 3127477..3128028 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  JR441_RS16145 (JR441_16145) yueI 3128125..3128523 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=536637 JR441_RS16115 WP_003220708.1 3123677..3123817(-) (degQ) [Bacillus subtilis strain BIM B-569G]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=536637 JR441_RS16115 WP_003220708.1 3123677..3123817(-) (degQ) [Bacillus subtilis strain BIM B-569G]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1