Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   I6G24_RS11470 Genome accession   NZ_CP084189
Coordinates   2195404..2195688 (+) Length   94 a.a.
NCBI ID   WP_010906314.1    Uniprot ID   Q9CDU4
Organism   Lactococcus lactis strain FDAARGOS_867     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2190404..2200688
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6G24_RS11440 (I6G24_11445) comGA 2191995..2192933 (+) 939 WP_031561106.1 competence type IV pilus ATPase ComGA Machinery gene
  I6G24_RS11445 (I6G24_11450) comGB 2192827..2193900 (+) 1074 WP_010906319.1 competence type IV pilus assembly protein ComGB Machinery gene
  I6G24_RS11450 (I6G24_11455) comGC 2194028..2194297 (+) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  I6G24_RS11455 (I6G24_11460) comGD 2194272..2194688 (+) 417 WP_225509978.1 competence type IV pilus minor pilin ComGD Machinery gene
  I6G24_RS11460 (I6G24_11465) comGE 2194660..2194956 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  I6G24_RS11465 (I6G24_11470) comGF 2194919..2195365 (+) 447 WP_031558968.1 competence type IV pilus minor pilin ComGF Machinery gene
  I6G24_RS11470 (I6G24_11475) comGG 2195404..2195688 (+) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  I6G24_RS11475 (I6G24_11480) - 2195769..2196206 (+) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  I6G24_RS11480 (I6G24_11485) - 2196203..2197045 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  I6G24_RS11485 (I6G24_11490) - 2197222..2197959 (+) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  I6G24_RS11490 (I6G24_11495) - 2197952..2198761 (+) 810 WP_010906310.1 metal ABC transporter permease -
  I6G24_RS11495 (I6G24_11500) - 2198800..2199666 (-) 867 WP_010906309.1 RluA family pseudouridine synthase -
  I6G24_RS11500 (I6G24_11505) - 2199871..2200248 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=534400 I6G24_RS11470 WP_010906314.1 2195404..2195688(+) (comGG) [Lactococcus lactis strain FDAARGOS_867]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=534400 I6G24_RS11470 WP_010906314.1 2195404..2195688(+) (comGG) [Lactococcus lactis strain FDAARGOS_867]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9CDU4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585