Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   K4756_RS12180 Genome accession   NZ_CP081458
Coordinates   2377132..2377515 (-) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain ps4060     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2372132..2382515
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K4756_RS12140 (K4756_12070) sinI 2373067..2373240 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K4756_RS12145 (K4756_12075) sinR 2373274..2373609 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K4756_RS12150 (K4756_12080) tasA 2373702..2374487 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  K4756_RS12155 (K4756_12085) sipW 2374551..2375123 (-) 573 WP_080030740.1 signal peptidase I SipW -
  K4756_RS12160 (K4756_12090) tapA 2375107..2375868 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  K4756_RS12165 (K4756_12095) yqzG 2376138..2376464 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  K4756_RS12170 (K4756_12100) spoIITA 2376506..2376685 (-) 180 WP_003230176.1 YqzE family protein -
  K4756_RS12175 (K4756_12105) comGG 2376757..2377131 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  K4756_RS12180 (K4756_12110) comGF 2377132..2377515 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  K4756_RS12185 (K4756_12115) comGE 2377541..2377888 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  K4756_RS12190 (K4756_12120) comGD 2377872..2378303 (-) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  K4756_RS12195 (K4756_12125) comGC 2378293..2378589 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  K4756_RS12200 (K4756_12130) comGB 2378603..2379639 (-) 1037 Protein_2357 comG operon protein ComGB -
  K4756_RS12205 (K4756_12135) comGA 2379626..2380696 (-) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  K4756_RS12210 (K4756_12140) corA 2381106..2382059 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=522500 K4756_RS12180 WP_015384087.1 2377132..2377515(-) (comGF) [Bacillus subtilis subsp. subtilis strain ps4060]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=522500 K4756_RS12180 WP_015384087.1 2377132..2377515(-) (comGF) [Bacillus subtilis subsp. subtilis strain ps4060]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984