Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KMZ16_RS16280 Genome accession   NZ_CP076445
Coordinates   3124842..3124982 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain ps4100     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3119842..3129982
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KMZ16_RS16255 (KMZ16_16105) yuxO 3120118..3120498 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  KMZ16_RS16260 (KMZ16_16110) comA 3120517..3121161 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KMZ16_RS16265 (KMZ16_16115) comP 3121242..3123554 (-) 2313 WP_069703660.1 histidine kinase Regulator
  KMZ16_RS16270 (KMZ16_16120) comX 3123570..3123791 (-) 222 WP_014480704.1 competence pheromone ComX -
  KMZ16_RS16275 (KMZ16_16125) comQ 3123793..3124656 (-) 864 WP_043858576.1 polyprenyl synthetase family protein Regulator
  KMZ16_RS16280 (KMZ16_16130) degQ 3124842..3124982 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KMZ16_RS16285 - 3125204..3125266 (+) 63 Protein_3148 hypothetical protein -
  KMZ16_RS16290 (KMZ16_16135) - 3125444..3125812 (+) 369 WP_017695529.1 hypothetical protein -
  KMZ16_RS16295 (KMZ16_16140) pdeH 3125788..3127017 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KMZ16_RS16300 (KMZ16_16145) pncB 3127154..3128626 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KMZ16_RS16305 (KMZ16_16150) pncA 3128642..3129193 (-) 552 WP_038828671.1 cysteine hydrolase family protein -
  KMZ16_RS16310 (KMZ16_16155) yueI 3129290..3129688 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=502550 KMZ16_RS16280 WP_003220708.1 3124842..3124982(-) (degQ) [Bacillus subtilis subsp. subtilis strain ps4100]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=502550 KMZ16_RS16280 WP_003220708.1 3124842..3124982(-) (degQ) [Bacillus subtilis subsp. subtilis strain ps4100]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1