Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | IB936_RS03990 | Genome accession | NZ_CP061133 |
| Coordinates | 787147..787335 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain BSAC_bs472 isolate Invasive disease | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 755112..793927 | 787147..787335 | within | 0 |
Gene organization within MGE regions
Location: 755112..793927
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB936_RS03795 (IB936_03795) | - | 755112..755747 (+) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
| IB936_RS03800 (IB936_03800) | rnz | 755762..756691 (+) | 930 | WP_009881223.1 | ribonuclease Z | - |
| IB936_RS03805 (IB936_03805) | - | 756691..757455 (+) | 765 | WP_002984893.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| IB936_RS03810 (IB936_03810) | recJ | 757452..759662 (+) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| IB936_RS03815 (IB936_03815) | - | 759813..760331 (+) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| IB936_RS03820 (IB936_03820) | - | 760412..761095 (+) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| IB936_RS03825 (IB936_03825) | nth | 761092..761748 (+) | 657 | WP_002990106.1 | endonuclease III | - |
| IB936_RS03830 (IB936_03830) | - | 761820..762506 (+) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase | - |
| IB936_RS03835 (IB936_03835) | - | 762496..763284 (+) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| IB936_RS03840 (IB936_03840) | - | 763324..764430 (+) | 1107 | WP_011528537.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| IB936_RS03845 (IB936_03845) | rfbA | 764488..765357 (+) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| IB936_RS03850 (IB936_03850) | - | 765357..765950 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| IB936_RS03855 (IB936_03855) | rfbB | 766194..767234 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| IB936_RS03860 (IB936_03860) | - | 767317..768252 (-) | 936 | WP_060388510.1 | tyrosine-type recombinase/integrase | - |
| IB936_RS03865 (IB936_03865) | - | 768399..768719 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| IB936_RS03870 (IB936_03870) | - | 768703..769059 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| IB936_RS09395 | - | 769056..769307 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| IB936_RS03875 (IB936_03875) | - | 769316..769525 (+) | 210 | Protein_734 | DUF4355 domain-containing protein | - |
| IB936_RS03880 (IB936_03880) | - | 769544..770434 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| IB936_RS03885 (IB936_03885) | - | 770446..770739 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| IB936_RS03890 (IB936_03890) | - | 770753..771097 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| IB936_RS03895 (IB936_03895) | - | 771094..771405 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| IB936_RS03900 (IB936_03900) | - | 771402..771797 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| IB936_RS03905 (IB936_03905) | - | 771799..772209 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| IB936_RS03910 (IB936_03910) | - | 772224..772478 (+) | 255 | WP_231494232.1 | phage major tail protein, TP901-1 family | - |
| IB936_RS03915 (IB936_03915) | - | 772491..772781 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| IB936_RS03920 (IB936_03920) | - | 772738..774315 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| IB936_RS03925 (IB936_03925) | - | 774316..775800 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| IB936_RS03930 (IB936_03930) | - | 775801..779250 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| IB936_RS03935 (IB936_03935) | - | 779255..781117 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| IB936_RS03940 (IB936_03940) | - | 781128..781475 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| IB936_RS09355 | - | 781489..781611 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| IB936_RS03945 (IB936_03945) | - | 781625..781948 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| IB936_RS03950 (IB936_03950) | - | 781948..782280 (+) | 333 | WP_011054798.1 | phage holin | - |
| IB936_RS03955 (IB936_03955) | - | 782282..783046 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| IB936_RS03960 (IB936_03960) | - | 783058..783660 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| IB936_RS03965 (IB936_03965) | - | 783671..784444 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| IB936_RS03970 (IB936_03970) | - | 784454..784675 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| IB936_RS03975 (IB936_03975) | - | 784675..785334 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| IB936_RS03980 (IB936_03980) | - | 785403..785837 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| IB936_RS03985 (IB936_03985) | sda3 | 786109..786909 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| IB936_RS03990 (IB936_03990) | prx | 787147..787335 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| IB936_RS03995 (IB936_03995) | - | 787743..788219 (+) | 477 | WP_002984880.1 | NUDIX hydrolase | - |
| IB936_RS04000 (IB936_04000) | - | 788277..789458 (+) | 1182 | WP_002984879.1 | AI-2E family transporter | - |
| IB936_RS04005 (IB936_04005) | - | 789448..790695 (+) | 1248 | WP_002984878.1 | tetratricopeptide repeat protein | - |
| IB936_RS04010 (IB936_04010) | fbp54 | 790754..792406 (-) | 1653 | WP_021299312.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| IB936_RS04015 (IB936_04015) | trpX | 792760..793758 (+) | 999 | WP_011184452.1 | tryptophan ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=480930 IB936_RS03990 WP_011528571.1 787147..787335(+) (prx) [Streptococcus pyogenes strain BSAC_bs472 isolate Invasive disease]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=480930 IB936_RS03990 WP_011528571.1 787147..787335(+) (prx) [Streptococcus pyogenes strain BSAC_bs472 isolate Invasive disease]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |