Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   IBL27_RS01310 Genome accession   NZ_CP061071
Coordinates   264376..264606 (+) Length   76 a.a.
NCBI ID   WP_002309764.1    Uniprot ID   -
Organism   Streptococcus mutans B04Sm5     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 259376..269606
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IBL27_RS01285 (IBL27_01285) - 259952..260578 (+) 627 WP_002278266.1 hypothetical protein -
  IBL27_RS01290 (IBL27_01290) - 260626..261264 (+) 639 WP_002265117.1 VTT domain-containing protein -
  IBL27_RS01295 (IBL27_01295) comE/blpR 261735..262487 (+) 753 WP_002270252.1 response regulator transcription factor Regulator
  IBL27_RS01300 (IBL27_01300) comD/blpH 262484..263809 (+) 1326 WP_002308983.1 sensor histidine kinase Regulator
  IBL27_RS01305 (IBL27_01305) comC/blpC 263978..264109 (-) 132 WP_002268639.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  IBL27_RS01310 (IBL27_01310) cipB 264376..264606 (+) 231 WP_002309764.1 Blp family class II bacteriocin Regulator
  IBL27_RS01315 (IBL27_01315) - 264737..265138 (+) 402 WP_002310604.1 hypothetical protein -
  IBL27_RS01320 (IBL27_01320) - 266518..266937 (+) 420 WP_002263913.1 hypothetical protein -
  IBL27_RS01325 (IBL27_01325) - 267084..267488 (+) 405 WP_002263912.1 hypothetical protein -
  IBL27_RS09845 - 267611..267823 (-) 213 Protein_238 IS3 family transposase -
  IBL27_RS01330 (IBL27_01330) - 268263..268427 (+) 165 WP_002265308.1 hypothetical protein -
  IBL27_RS01335 (IBL27_01335) - 268832..269044 (+) 213 WP_002309424.1 Blp family class II bacteriocin -
  IBL27_RS01340 (IBL27_01340) - 269208..269396 (+) 189 WP_002309422.1 Blp family class II bacteriocin -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7258.07 Da        Isoelectric Point: 3.7781

>NTDB_id=480229 IBL27_RS01310 WP_002309764.1 264376..264606(+) (cipB) [Streptococcus mutans B04Sm5]
MNTQAFEQFNVIDNEALSAIEGGGRGWNCAAGIALGAGQGYMATAGGTAFLGPYAIGTGAFGAIAGGIGGALNSCG

Nucleotide


Download         Length: 231 bp        

>NTDB_id=480229 IBL27_RS01310 WP_002309764.1 264376..264606(+) (cipB) [Streptococcus mutans B04Sm5]
ATGAATACACAAGCATTTGAACAATTTAACGTAATAGATAATGAAGCACTTTCAGCTATTGAAGGTGGGGGCCGCGGATG
GAATTGTGCAGCAGGTATTGCTCTAGGTGCTGGGCAAGGTTATATGGCTACTGCAGGCGGTACAGCATTTCTTGGTCCAT
ATGCTATTGGCACTGGTGCCTTTGGGGCTATTGCTGGAGGAATCGGAGGAGCTCTTAATTCCTGTGGTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

97.368

100

0.974