Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C663_RS11985 Genome accession   NC_020244
Coordinates   2409373..2409756 (-) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis XF-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2404373..2414756
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C663_RS11945 (C663_2343) sinI 2405308..2405481 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  C663_RS11950 (C663_2344) sinR 2405515..2405850 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C663_RS11955 (C663_2345) tasA 2405943..2406728 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  C663_RS11960 (C663_2346) sipW 2406792..2407364 (-) 573 WP_080030740.1 signal peptidase I -
  C663_RS11965 (C663_2347) tapA 2407348..2408109 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  C663_RS11970 (C663_2348) yqzG 2408379..2408705 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  C663_RS11975 (C663_2349) spoIIT 2408747..2408926 (-) 180 WP_003230176.1 YqzE family protein -
  C663_RS11980 (C663_2350) comGG 2408998..2409372 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  C663_RS11985 (C663_2351) comGF 2409373..2409756 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  C663_RS11990 (C663_2352) comGE 2409782..2410129 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  C663_RS11995 (C663_2353) comGD 2410113..2410544 (-) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  C663_RS12000 (C663_2354) comGC 2410534..2410830 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  C663_RS12005 comGB 2410844..2411881 (-) 1038 WP_015483430.1 comG operon protein ComGB Machinery gene
  C663_RS12010 (C663_2356) comGA 2411868..2412938 (-) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  C663_RS12015 (C663_2358) corA 2413348..2414301 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=45789 C663_RS11985 WP_015384087.1 2409373..2409756(-) (comGF) [Bacillus subtilis XF-1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=45789 C663_RS11985 WP_015384087.1 2409373..2409756(-) (comGF) [Bacillus subtilis XF-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment