Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPAKL117_RS00195 Genome accession   NC_019560
Coordinates   35527..35640 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   -
Organism   Helicobacter pylori Aklavik117     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30527..40640
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPAKL117_RS00170 (HPAKL117_00145) - 30590..32809 (+) 2220 WP_015085298.1 AAA family ATPase -
  HPAKL117_RS00175 (HPAKL117_00150) panD 32799..33149 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HPAKL117_RS00180 (HPAKL117_00155) - 33160..33453 (+) 294 WP_015085299.1 YbaB/EbfC family nucleoid-associated protein -
  HPAKL117_RS00185 (HPAKL117_00160) - 33453..34448 (+) 996 WP_015085300.1 PDZ domain-containing protein -
  HPAKL117_RS00190 (HPAKL117_00165) comB6 34456..35511 (+) 1056 WP_015085301.1 type IV secretion system protein Machinery gene
  HPAKL117_RS00195 (HPAKL117_00170) comB7 35527..35640 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HPAKL117_RS00200 (HPAKL117_00175) comB8 35637..36374 (+) 738 WP_015085302.1 type IV secretion system protein Machinery gene
  HPAKL117_RS00205 (HPAKL117_00180) comB9 36374..37342 (+) 969 WP_015085303.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPAKL117_RS00210 (HPAKL117_00185) comB10 37335..38471 (+) 1137 WP_015085304.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPAKL117_RS00215 (HPAKL117_00190) - 38538..39950 (+) 1413 WP_015085305.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=45269 HPAKL117_RS00195 WP_001217868.1 35527..35640(+) (comB7) [Helicobacter pylori Aklavik117]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=45269 HPAKL117_RS00195 WP_001217868.1 35527..35640(+) (comB7) [Helicobacter pylori Aklavik117]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACGCTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment