Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   I6G80_RS12540 Genome accession   NZ_CP065647
Coordinates   2347883..2348254 (+) Length   123 a.a.
NCBI ID   WP_003183461.1    Uniprot ID   -
Organism   Bacillus licheniformis strain FDAARGOS_923     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2342883..2353254
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6G80_RS12500 (I6G80_12500) - 2343073..2343450 (+) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  I6G80_RS12510 (I6G80_12510) - 2343692..2344531 (+) 840 WP_003183480.1 STAS domain-containing protein -
  I6G80_RS12515 (I6G80_12515) comGA 2344688..2345752 (+) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  I6G80_RS12520 (I6G80_12520) comGB 2345742..2346776 (+) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  I6G80_RS12525 (I6G80_12525) comGC 2346790..2347083 (+) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  I6G80_RS12530 (I6G80_12530) comGD 2347089..2347526 (+) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  I6G80_RS12535 (I6G80_12535) comGE 2347510..2347857 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  I6G80_RS12540 (I6G80_12540) comGF 2347883..2348254 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF Machinery gene
  I6G80_RS12545 (I6G80_12545) comGG 2348267..2348632 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  I6G80_RS12550 (I6G80_12550) - 2348721..2348903 (+) 183 WP_003183456.1 YqzE family protein -
  I6G80_RS12555 (I6G80_12555) - 2348927..2349247 (-) 321 WP_003183454.1 YqzG/YhdC family protein -
  I6G80_RS12560 (I6G80_12560) tapA 2349524..2350252 (+) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  I6G80_RS12565 (I6G80_12565) sipW 2350249..2350833 (+) 585 WP_003183449.1 signal peptidase I SipW -
  I6G80_RS12570 (I6G80_12570) tasA 2350907..2351701 (+) 795 WP_003183447.1 biofilm matrix protein TasA -
  I6G80_RS12575 (I6G80_12575) sinR 2351806..2352141 (-) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  I6G80_RS12580 (I6G80_12580) sinI 2352175..2352351 (-) 177 WP_003183444.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 123 a.a.        Molecular weight: 14179.31 Da        Isoelectric Point: 10.3094

>NTDB_id=450428 I6G80_RS12540 WP_003183461.1 2347883..2348254(+) (comGF) [Bacillus licheniformis strain FDAARGOS_923]
MFVAGTMASIFHLFLSPERNGSDIHPREWTITAEQILKESRNSIDIRSAGDHQSLAMTNRQGDTVRYEQYQTVIRKRVNG
KGHVPLLQHVKKMRFMIENHLLILEATSLSGKSYRTSIPLYHM

Nucleotide


Download         Length: 372 bp        

>NTDB_id=450428 I6G80_RS12540 WP_003183461.1 2347883..2348254(+) (comGF) [Bacillus licheniformis strain FDAARGOS_923]
ATGTTCGTTGCAGGTACGATGGCCTCGATATTTCATCTGTTTTTATCCCCGGAAAGAAACGGTTCGGATATTCACCCCCG
TGAATGGACGATTACTGCCGAGCAAATATTGAAGGAGTCTAGGAATTCGATTGACATAAGAAGTGCCGGTGATCATCAGT
CACTAGCGATGACAAACCGCCAAGGTGACACCGTTCGCTATGAGCAATATCAGACAGTTATTCGAAAAAGGGTCAATGGA
AAAGGTCATGTGCCTCTATTACAGCATGTCAAAAAAATGAGGTTTATGATTGAAAATCACCTGCTGATCCTTGAAGCGAC
AAGTCTAAGCGGCAAATCATACCGCACGTCTATTCCGCTCTATCATATGTAA

Domains

Predicted by InterProScan.

Putative Competence protein ComGF (ComGF)

(19-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

38.843

98.374

0.382