Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   STAVA1121_RS04710 Genome accession   NZ_CP065488
Coordinates   876880..877080 (+) Length   66 a.a.
NCBI ID   WP_006531882.1    Uniprot ID   A0ABP2DHE2
Organism   Streptococcus thermophilus strain AVA1121     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 871880..882080
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  STAVA1121_RS04665 (STAVA1121_04595) - 873518..873739 (+) 222 WP_101415610.1 Blp family class II bacteriocin -
  STAVA1121_RS04670 (STAVA1121_04600) - 873791..874018 (+) 228 WP_058621356.1 bacteriocin class II family protein -
  STAVA1121_RS04675 (STAVA1121_04605) - 874040..874423 (+) 384 WP_095559354.1 hypothetical protein -
  STAVA1121_RS04680 (STAVA1121_04610) - 874420..874623 (+) 204 Protein_864 garvicin Q family class II bacteriocin -
  STAVA1121_RS04685 (STAVA1121_04615) - 874635..874937 (+) 303 WP_015695689.1 bacteriocin immunity protein -
  STAVA1121_RS04690 (STAVA1121_04620) - 875095..875328 (+) 234 WP_095559355.1 Blp family class II bacteriocin -
  STAVA1121_RS04695 (STAVA1121_04625) - 875518..875775 (+) 258 WP_095559356.1 garvicin Q family class II bacteriocin -
  STAVA1121_RS04700 (STAVA1121_04630) - 875775..876083 (+) 309 WP_018364976.1 bacteriocin immunity protein -
  STAVA1121_RS04705 (STAVA1121_04635) - 876458..876637 (+) 180 WP_095559357.1 hypothetical protein -
  STAVA1121_RS04710 (STAVA1121_04640) cipB 876880..877080 (+) 201 WP_006531882.1 bacteriocin class II family protein Regulator
  STAVA1121_RS04715 (STAVA1121_04645) - 877106..877288 (+) 183 WP_006531883.1 Blp family class II bacteriocin -
  STAVA1121_RS04720 (STAVA1121_04650) - 877905..878135 (+) 231 WP_043878356.1 bacteriocin -
  STAVA1121_RS04725 (STAVA1121_04655) - 878224..878535 (+) 312 WP_347131537.1 hypothetical protein -
  STAVA1121_RS04730 (STAVA1121_04660) - 878748..878840 (+) 93 Protein_874 Blp family class II bacteriocin -
  STAVA1121_RS04735 (STAVA1121_04665) - 878898..879302 (+) 405 WP_015695682.1 hypothetical protein -
  STAVA1121_RS04740 (STAVA1121_04670) - 879483..880529 (+) 1047 WP_095559358.1 thioredoxin fold domain-containing protein -
  STAVA1121_RS04745 (STAVA1121_04675) - 881061..881825 (+) 765 WP_232086163.1 DUF6261 family protein -

Sequence


Protein


Download         Length: 66 a.a.        Molecular weight: 6536.51 Da        Isoelectric Point: 6.1394

>NTDB_id=448525 STAVA1121_RS04710 WP_006531882.1 876880..877080(+) (cipB) [Streptococcus thermophilus strain AVA1121]
MNTKAFEQFDVMTDAELSTVEGGKSKEGRNMGCILGTAGMAGAGFLVAGPAGAAALGGATALRVCR

Nucleotide


Download         Length: 201 bp        

>NTDB_id=448525 STAVA1121_RS04710 WP_006531882.1 876880..877080(+) (cipB) [Streptococcus thermophilus strain AVA1121]
ATGAATACAAAAGCATTTGAACAATTTGATGTAATGACAGATGCAGAACTTTCAACTGTTGAAGGTGGGAAAAGTAAAGA
AGGAAGAAATATGGGATGTATACTTGGCACTGCAGGTATGGCAGGAGCAGGCTTTTTAGTAGCAGGACCAGCAGGTGCTG
CCGCACTTGGCGGTGCTACCGCACTAAGAGTTTGTAGATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.174

69.697

0.364