Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   IRJ28_RS05740 Genome accession   NZ_CP064096
Coordinates   1082442..1082825 (+) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain N1142-3at     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1077442..1087825
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ28_RS05710 corA 1077895..1078848 (+) 954 WP_004399136.1 magnesium transporter CorA -
  IRJ28_RS05715 comGA 1079260..1080330 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  IRJ28_RS05720 comGB 1080317..1081354 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  IRJ28_RS05725 comGC 1081368..1081664 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  IRJ28_RS05730 comGD 1081654..1082085 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  IRJ28_RS05735 comGE 1082069..1082416 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  IRJ28_RS05740 comGF 1082442..1082825 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  IRJ28_RS05745 comGG 1082826..1083200 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  IRJ28_RS05750 spoIIT 1083271..1083450 (+) 180 WP_003230176.1 YqzE family protein -
  IRJ28_RS05755 yqzG 1083492..1083818 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  IRJ28_RS05760 tapA 1084090..1084851 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  IRJ28_RS05765 sipW 1084835..1085407 (+) 573 WP_003246088.1 signal peptidase I -
  IRJ28_RS05770 tasA 1085471..1086256 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  IRJ28_RS05775 sinR 1086349..1086684 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IRJ28_RS05780 sinI 1086718..1086891 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=442175 IRJ28_RS05740 WP_003230168.1 1082442..1082825(+) (comGF) [Bacillus subtilis strain N1142-3at]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=442175 IRJ28_RS05740 WP_003230168.1 1082442..1082825(+) (comGF) [Bacillus subtilis strain N1142-3at]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1