Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | G8B38_RS04350 | Genome accession | NZ_CP049694 |
| Coordinates | 836701..836889 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain ABC122 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 814910..843481 | 836701..836889 | within | 0 |
Gene organization within MGE regions
Location: 814910..843481
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G8B38_RS04210 (G8B38_04245) | - | 814910..815503 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| G8B38_RS04215 (G8B38_04250) | rfbB | 815747..816787 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| G8B38_RS04220 (G8B38_04255) | - | 816870..817805 (-) | 936 | WP_060388510.1 | site-specific integrase | - |
| G8B38_RS04225 (G8B38_04260) | - | 817952..818272 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| G8B38_RS04230 (G8B38_04265) | - | 818256..818612 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| G8B38_RS09420 | - | 818609..818860 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| G8B38_RS04235 (G8B38_04270) | - | 818869..819078 (+) | 210 | Protein_793 | DUF4355 domain-containing protein | - |
| G8B38_RS04240 (G8B38_04275) | - | 819097..819987 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| G8B38_RS04245 (G8B38_04280) | - | 819999..820292 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| G8B38_RS04250 (G8B38_04285) | - | 820306..820650 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| G8B38_RS04255 (G8B38_04290) | - | 820647..820958 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| G8B38_RS04260 (G8B38_04295) | - | 820955..821350 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| G8B38_RS04265 (G8B38_04300) | - | 821352..821762 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| G8B38_RS04270 (G8B38_04305) | - | 821777..822031 (+) | 255 | WP_231494232.1 | phage major tail protein, TP901-1 family | - |
| G8B38_RS04275 (G8B38_04310) | - | 822044..822334 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| G8B38_RS04280 (G8B38_04315) | - | 822291..823868 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| G8B38_RS04285 (G8B38_04320) | - | 823869..825354 (+) | 1486 | Protein_803 | distal tail protein Dit | - |
| G8B38_RS04290 (G8B38_04325) | - | 825355..828804 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| G8B38_RS04295 (G8B38_04330) | - | 828809..830671 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| G8B38_RS04300 (G8B38_04335) | - | 830682..831029 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| G8B38_RS09335 | - | 831043..831165 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| G8B38_RS04305 (G8B38_04340) | - | 831179..831502 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| G8B38_RS04310 (G8B38_04345) | - | 831502..831834 (+) | 333 | WP_011054798.1 | phage holin | - |
| G8B38_RS04315 (G8B38_04350) | - | 831836..832600 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| G8B38_RS04320 (G8B38_04355) | - | 832612..833214 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| G8B38_RS04325 (G8B38_04360) | - | 833225..833998 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| G8B38_RS04330 (G8B38_04365) | - | 834008..834229 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| G8B38_RS04335 (G8B38_04370) | - | 834229..834888 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| G8B38_RS04340 (G8B38_04375) | - | 834957..835391 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| G8B38_RS04345 (G8B38_04380) | sda3 | 835663..836463 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| G8B38_RS04350 (G8B38_04385) | prx | 836701..836889 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| G8B38_RS04355 (G8B38_04390) | - | 837297..837773 (+) | 477 | WP_002984880.1 | 8-oxo-dGTP diphosphatase | - |
| G8B38_RS04360 (G8B38_04395) | - | 837831..839012 (+) | 1182 | WP_002984879.1 | AI-2E family transporter | - |
| G8B38_RS04365 (G8B38_04400) | - | 839002..840249 (+) | 1248 | WP_002984878.1 | tetratricopeptide repeat protein | - |
| G8B38_RS04370 (G8B38_04405) | fbp54 | 840308..841960 (-) | 1653 | WP_021299312.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| G8B38_RS04375 (G8B38_04410) | trpX | 842314..843312 (+) | 999 | WP_011184452.1 | tryptophan ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=427092 G8B38_RS04350 WP_011528571.1 836701..836889(+) (prx) [Streptococcus pyogenes strain ABC122]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=427092 G8B38_RS04350 WP_011528571.1 836701..836889(+) (prx) [Streptococcus pyogenes strain ABC122]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |