Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BAINH2_RS11610 Genome accession   NZ_CP061852
Coordinates   2458051..2458428 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain INH2-4b     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2453051..2463428
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAINH2_RS11570 (BAINH2_11570) - 2453549..2454343 (+) 795 WP_007408330.1 YqhG family protein -
  BAINH2_RS11575 (BAINH2_11575) sinI 2454520..2454693 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  BAINH2_RS11580 (BAINH2_11580) sinR 2454727..2455062 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAINH2_RS11585 (BAINH2_11585) tasA 2455110..2455895 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAINH2_RS11590 (BAINH2_11590) sipW 2455960..2456544 (-) 585 WP_015240205.1 signal peptidase I SipW -
  BAINH2_RS11595 (BAINH2_11595) tapA 2456516..2457187 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  BAINH2_RS11600 (BAINH2_11600) - 2457446..2457775 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  BAINH2_RS11605 (BAINH2_11605) - 2457815..2457994 (-) 180 WP_003153093.1 YqzE family protein -
  BAINH2_RS11610 (BAINH2_11610) comGG 2458051..2458428 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAINH2_RS11615 (BAINH2_11615) comGF 2458429..2458929 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  BAINH2_RS11620 (BAINH2_11620) comGE 2458838..2459152 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAINH2_RS11625 (BAINH2_11625) comGD 2459136..2459573 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAINH2_RS11630 (BAINH2_11630) comGC 2459563..2459871 (-) 309 WP_079979070.1 competence type IV pilus major pilin ComGC Machinery gene
  BAINH2_RS11635 (BAINH2_11635) comGB 2459876..2460913 (-) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAINH2_RS11640 (BAINH2_11640) comGA 2460900..2461970 (-) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  BAINH2_RS11645 (BAINH2_11645) - 2462163..2463113 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=423203 BAINH2_RS11610 WP_015417814.1 2458051..2458428(-) (comGG) [Bacillus amyloliquefaciens strain INH2-4b]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=423203 BAINH2_RS11610 WP_015417814.1 2458051..2458428(-) (comGG) [Bacillus amyloliquefaciens strain INH2-4b]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504


Multiple sequence alignment