Detailed information NTG0416486

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: E3S81_RS13945
• Genome accession: NZ_CP047794
• Coordinates: 2832726..2833196 (+)
• Length: 156 a.a.
• NCBI ID: WP_106459810.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain UP_551
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	2828050..2836248	2832726..2833196	within	0

Gene organization within MGE regions

Location: 2828050..2836248

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E3S81_RS13910 (E3S81_13910)	-	2828050..2828370 (+)	321	WP_001120935.1	DUF771 domain-containing protein	-
E3S81_RS13915 (E3S81_13915)	-	2828367..2828528 (+)	162	WP_000066020.1	DUF1270 domain-containing protein	-
E3S81_RS13920 (E3S81_13920)	-	2828621..2828881 (+)	261	WP_000291489.1	DUF1108 family protein	-
E3S81_RS13925 (E3S81_13925)	-	2828890..2829153 (+)	264	WP_001205732.1	hypothetical protein	-
E3S81_RS13930 (E3S81_13930)	-	2829150..2831105 (+)	1956	WP_201749257.1	AAA family ATPase	-
E3S81_RS13935 (E3S81_13935)	-	2831107..2832027 (+)	921	WP_000138475.1	recombinase RecT	-
E3S81_RS13940 (E3S81_13940)	-	2832108..2832725 (+)	618	WP_236658092.1	MBL fold metallo-hydrolase	-
E3S81_RS13945 (E3S81_13945)	ssbA	2832726..2833196 (+)	471	WP_106459810.1	single-stranded DNA-binding protein	Machinery gene
E3S81_RS13950 (E3S81_13950)	-	2833226..2834110 (+)	885	WP_106459811.1	DnaD domain protein	-
E3S81_RS13955 (E3S81_13955)	-	2834117..2834335 (+)	219	WP_000338527.1	hypothetical protein	-
E3S81_RS13960 (E3S81_13960)	-	2834344..2834748 (+)	405	WP_106459812.1	RusA family crossover junction endodeoxyribonuclease	-
E3S81_RS13965 (E3S81_13965)	-	2834761..2835129 (+)	369	WP_000101270.1	SA1788 family PVL leukocidin-associated protein	-
E3S81_RS13970 (E3S81_13970)	-	2835133..2835375 (+)	243	WP_000131381.1	phi PVL orf 51-like protein	-
E3S81_RS13975 (E3S81_13975)	-	2835390..2835641 (+)	252	WP_001065046.1	DUF1024 family protein	-
E3S81_RS14075	-	2835631..2835804 (+)	174	WP_000028424.1	hypothetical protein	-
E3S81_RS14270	-	2835805..2835957 (+)	153	WP_016170781.1	hypothetical protein	-
E3S81_RS14080	-	2836087..2836248 (+)	162	WP_000889682.1	hypothetical protein	-

Sequence

Protein

• Length: 156 a.a.
• Molecular weight: 17657.52 Da
• Isoelectric Point: 5.2672

>NTDB_id=416486 E3S81_RS13945 WP_106459810.1 2832726..2833196(+) (ssbA) [Staphylococcus aureus strain UP_551]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide

• Length: 471 bp

>NTDB_id=416486 E3S81_RS13945 WP_106459810.1 2832726..2833196(+) (ssbA) [Staphylococcus aureus strain UP_551]
ATGATAAATAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCGGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	54.802	100	0.622
ssb	Latilactobacillus sakei subsp. sakei 23K	51.765	100	0.564
ssbB	Bacillus subtilis subsp. subtilis str. 168	59.434	67.949	0.404
ssb	Vibrio cholerae strain A1552	32.402	100	0.372
ssb	Neisseria meningitidis MC58	32.948	100	0.365
ssb	Neisseria gonorrhoeae MS11	32.948	100	0.365