Detailed information NTG0414628

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GU336_RS01535
• Genome accession: NZ_CP047616
• Coordinates: 297840..298160 (+)
• Length: 106 a.a.
• NCBI ID: WP_061774318.1
• Uniprot ID: A0A290PY35
• Organism: Lactococcus raffinolactis strain Lr_19_5
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 292840..303160

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GU336_RS01515 (GU336_01515)	-	293657..294019 (+)	363	WP_061774315.1	hypothetical protein	-
GU336_RS01520 (GU336_01520)	-	294016..295860 (+)	1845	WP_167838307.1	acyltransferase family protein	-
GU336_RS01525 (GU336_01525)	comGA/cglA/cilD	295923..296864 (+)	942	WP_061774317.1	competence type IV pilus ATPase ComGA	Machinery gene
GU336_RS01530 (GU336_01530)	comYB	296746..297831 (+)	1086	WP_310592697.1	competence type IV pilus assembly protein ComGB	Machinery gene
GU336_RS01535 (GU336_01535)	comYC	297840..298160 (+)	321	WP_061774318.1	competence type IV pilus major pilin ComGC	Machinery gene
GU336_RS01540 (GU336_01540)	comGD	298111..298560 (+)	450	WP_167838308.1	competence type IV pilus minor pilin ComGD	-
GU336_RS01545 (GU336_01545)	comGE	298532..298837 (+)	306	WP_082785376.1	competence type IV pilus minor pilin ComGE	-
GU336_RS01550 (GU336_01550)	comGF	298812..299255 (+)	444	WP_244165991.1	competence type IV pilus minor pilin ComGF	-
GU336_RS01555 (GU336_01555)	comGG	299267..299551 (+)	285	WP_096039677.1	competence type IV pilus minor pilin ComGG	-
GU336_RS01560 (GU336_01560)	ispE	299556..300407 (+)	852	WP_061774322.1	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	-
GU336_RS01565 (GU336_01565)	-	300491..301339 (+)	849	WP_167838309.1	aminotransferase class IV	-
GU336_RS01570 (GU336_01570)	-	301415..301864 (+)	450	WP_061774324.1	zinc-dependent MarR family transcriptional regulator	-
GU336_RS01575 (GU336_01575)	-	301864..302634 (+)	771	WP_244165990.1	metal ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11969.96 Da
• Isoelectric Point: 9.8991

>NTDB_id=414628 GU336_RS01535 WP_061774318.1 297840..298160(+) (comYC) [Lactococcus raffinolactis strain Lr_19_5]
MKKEDMKKKIVRAFTLVEMLVVLLVISVLILLFIPNLSKQKETVKNTGNGAVVKVVNSQAELYRLDHTDDVTLGKLVSNG
NITQKQADAYNEYYKKNTTESREIPS

Nucleotide

• Length: 321 bp

>NTDB_id=414628 GU336_RS01535 WP_061774318.1 297840..298160(+) (comYC) [Lactococcus raffinolactis strain Lr_19_5]
CTGAAGAAAGAAGATATGAAGAAAAAAATAGTACGTGCTTTTACTTTAGTAGAAATGCTAGTTGTTCTTCTTGTCATTAG
TGTCTTAATTTTATTGTTTATCCCCAATCTATCCAAACAAAAAGAGACTGTTAAGAATACAGGAAACGGCGCTGTTGTAA
AGGTAGTTAACTCGCAAGCGGAACTTTATAGATTAGACCATACTGATGATGTTACCTTAGGCAAGCTAGTCAGCAATGGC
AATATCACACAAAAACAGGCGGATGCTTATAATGAGTACTATAAGAAGAACACAACAGAATCACGTGAAATTCCAAGCTA
G

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-32)

3D structure

• AlphaFold DB: A0A290PY35

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	66.337	95.283	0.632
comYC	Streptococcus mutans UA159	61.538	98.113	0.604
comYC	Streptococcus mutans UA140	61.538	98.113	0.604
comGC/cglC	Streptococcus mitis SK321	63.636	93.396	0.594
comGC/cglC	Streptococcus mitis NCTC 12261	62.887	91.509	0.575
comGC/cglC	Streptococcus pneumoniae R6	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae D39	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae TIGR4	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae Rx1	60.606	93.396	0.566
comGC	Lactococcus lactis subsp. cremoris KW2	59.783	86.792	0.519
comYC	Streptococcus suis isolate S10	57.5	75.472	0.434