Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   SPYALAB49_RS00670 Genome accession   NC_017596
Coordinates   104756..105040 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes Alab49     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99756..110040
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPYALAB49_RS00645 (SPYALAB49_000126) - 101702..102067 (+) 366 WP_002986560.1 DUF1033 family protein -
  SPYALAB49_RS00650 (SPYALAB49_000127) comGA 102160..103098 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  SPYALAB49_RS00655 (SPYALAB49_000128) comGB 103034..104068 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  SPYALAB49_RS00660 (SPYALAB49_000129) comGC 104070..104396 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  SPYALAB49_RS00665 (SPYALAB49_000130) comGD 104371..104799 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  SPYALAB49_RS00670 (SPYALAB49_000131) comGE 104756..105040 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  SPYALAB49_RS00675 (SPYALAB49_000132) comGF 105033..105467 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  SPYALAB49_RS00680 (SPYALAB49_000133) comGG 105451..105777 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  SPYALAB49_RS00685 (SPYALAB49_000134) comGH 105875..106828 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  SPYALAB49_RS00690 (SPYALAB49_000135) - 106888..108084 (+) 1197 WP_010921803.1 acetate kinase -
  SPYALAB49_RS00695 (SPYALAB49_000136) - 108271..108579 (+) 309 WP_011017251.1 hypothetical protein -
  SPYALAB49_RS00700 (SPYALAB49_000137) proC 108662..109432 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=40363 SPYALAB49_RS00670 WP_002987779.1 104756..105040(+) (comGE) [Streptococcus pyogenes Alab49]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=40363 SPYALAB49_RS00670 WP_002987779.1 104756..105040(+) (comGE) [Streptococcus pyogenes Alab49]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTGAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383