Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BSNT_RS12710 | Genome accession | NC_017196 |
| Coordinates | 2356309..2356482 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. natto BEST195 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2351309..2361482
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSNT_RS12695 (BSNT_03665) | gcvT | 2352108..2353196 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BSNT_RS12700 (BSNT_03666) | yqhH | 2353638..2355311 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| BSNT_RS12705 (BSNT_03668) | yqhG | 2355332..2356126 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| BSNT_RS12710 (BSNT_03669) | sinI | 2356309..2356482 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| BSNT_RS12715 (BSNT_03670) | sinR | 2356516..2356851 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| BSNT_RS12720 (BSNT_03671) | tasA | 2356944..2357729 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| BSNT_RS12725 (BSNT_03672) | sipW | 2357793..2358365 (-) | 573 | WP_003230181.1 | signal peptidase I | - |
| BSNT_RS12730 (BSNT_03673) | tapA | 2358349..2359110 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BSNT_RS12735 (BSNT_03674) | yqzG | 2359382..2359708 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| BSNT_RS12740 (BSNT_03676) | spoIIT | 2359750..2359929 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| BSNT_RS12745 (BSNT_03678) | comGG | 2360000..2360374 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| BSNT_RS12750 (BSNT_03680) | comGF | 2360375..2360758 (-) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| BSNT_RS12755 (BSNT_03681) | comGE | 2360784..2361131 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=36144 BSNT_RS12710 WP_003230187.1 2356309..2356482(+) (sinI) [Bacillus subtilis subsp. natto BEST195]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=36144 BSNT_RS12710 WP_003230187.1 2356309..2356482(+) (sinI) [Bacillus subtilis subsp. natto BEST195]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |