Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GSY53_RS02925 Genome accession   NZ_CP047325
Coordinates   555710..555850 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain GOT9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 550710..560850
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GSY53_RS02900 (GSY53_02900) yuxO 551060..551440 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  GSY53_RS02905 (GSY53_02905) comA 551459..552103 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GSY53_RS02910 (GSY53_02910) comP 552184..554481 (-) 2298 WP_033884760.1 histidine kinase Regulator
  GSY53_RS02915 (GSY53_02915) comX 554489..554650 (-) 162 WP_003228803.1 competence pheromone ComX -
  GSY53_RS02920 (GSY53_02920) comQ 554665..555525 (-) 861 WP_032677058.1 polyprenyl synthetase family protein Regulator
  GSY53_RS02925 (GSY53_02925) degQ 555710..555850 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GSY53_RS02930 (GSY53_02930) - 556072..556197 (+) 126 WP_003228793.1 hypothetical protein -
  GSY53_RS02935 (GSY53_02935) - 556311..556679 (+) 369 WP_014477834.1 hypothetical protein -
  GSY53_RS02940 (GSY53_02940) pdeH 556655..557884 (-) 1230 WP_003228790.1 cyclic di-GMP phosphodiesterase -
  GSY53_RS02945 (GSY53_02945) pncB 558021..559493 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GSY53_RS02950 (GSY53_02950) pncA 559509..560060 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  GSY53_RS02955 (GSY53_02955) yueI 560157..560555 (-) 399 WP_032677057.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=359273 GSY53_RS02925 WP_003220708.1 555710..555850(-) (degQ) [Bacillus subtilis strain GOT9]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=359273 GSY53_RS02925 WP_003220708.1 555710..555850(-) (degQ) [Bacillus subtilis strain GOT9]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1