Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | GL189_RS02445 | Genome accession | NZ_CP046360 |
| Coordinates | 473665..473814 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 574 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 468665..478814
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL189_RS02420 (GL189_02495) | comA/nlmT | 469732..471408 (-) | 1677 | WP_215729172.1 | peptide cleavage/export ABC transporter | Regulator |
| GL189_RS11260 | comA/nlmT | 471302..471889 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| GL189_RS02430 (GL189_02500) | blpI | 472171..472368 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| GL189_RS02435 (GL189_02505) | blpJ | 472835..473104 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| GL189_RS02440 (GL189_02510) | blpK | 473173..473421 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| GL189_RS02445 (GL189_02515) | cipB | 473665..473814 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| GL189_RS02450 (GL189_02520) | - | 473918..474037 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| GL189_RS02455 (GL189_02530) | - | 474518..474876 (+) | 359 | Protein_490 | immunity protein | - |
| GL189_RS02460 (GL189_02535) | - | 475505..475888 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| GL189_RS02465 (GL189_02540) | - | 475940..476629 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GL189_RS02470 (GL189_02545) | blpZ | 476671..476904 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| GL189_RS02475 (GL189_02550) | - | 477055..477666 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| GL189_RS02480 (GL189_02555) | ccrZ | 477827..478621 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=351326 GL189_RS02445 WP_001809846.1 473665..473814(+) (cipB) [Streptococcus pneumoniae strain 574]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=351326 GL189_RS02445 WP_001809846.1 473665..473814(+) (cipB) [Streptococcus pneumoniae strain 574]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |