Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   FSA40_RS02065 Genome accession   NZ_CP044493
Coordinates   383029..383259 (+) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans strain MD     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 378029..388259
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FSA40_RS02045 (FSA40_0404) - 378603..378899 (+) 297 WP_002263922.1 YlxR family protein -
  FSA40_RS02050 (FSA40_0405) - 378892..379194 (+) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  FSA40_RS02055 (FSA40_0406) infB 379215..381965 (+) 2751 WP_002296668.1 translation initiation factor IF-2 -
  FSA40_RS02060 (FSA40_0407) rbfA 382199..382549 (+) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  FSA40_RS10535 (FSA40_0408) - 382627..382761 (-) 135 WP_002267544.1 hypothetical protein -
  FSA40_RS02065 (FSA40_0409) cipB 383029..383259 (+) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  FSA40_RS02070 (FSA40_0410) - 383650..384093 (+) 444 WP_002267007.1 CopY/TcrY family copper transport repressor -
  FSA40_RS02075 (FSA40_0411) - 384090..386318 (+) 2229 WP_002267008.1 heavy metal translocating P-type ATPase -
  FSA40_RS02080 (FSA40_0412) copZ 386331..386534 (+) 204 WP_002264873.1 copper chaperone CopZ -
  FSA40_RS02085 (FSA40_0413) - 386780..387601 (+) 822 WP_032506494.1 Cof-type HAD-IIB family hydrolase -
  FSA40_RS02090 (FSA40_0414) - 387707..388198 (-) 492 WP_018110171.1 YgjV family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=342875 FSA40_RS02065 WP_002275977.1 383029..383259(+) (cipB) [Streptococcus mutans strain MD]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=342875 FSA40_RS02065 WP_002275977.1 383029..383259(+) (cipB) [Streptococcus mutans strain MD]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCTTTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395