Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   FY406_RS04480 Genome accession   NZ_CP043405
Coordinates   916280..916459 (+) Length   59 a.a.
NCBI ID   WP_003086713.1    Uniprot ID   A0ABN0GWW7
Organism   Streptococcus ratti strain ATCC 31377     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 911280..921459
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FY406_RS04460 (FY406_04460) - 911426..912592 (+) 1167 WP_003086730.1 DnaD domain protein -
  FY406_RS04465 (FY406_04465) dnaI 912593..913495 (+) 903 WP_003086728.1 primosomal protein DnaI -
  FY406_RS04470 (FY406_04470) der 913508..914818 (+) 1311 WP_003086718.1 ribosome biogenesis GTPase Der -
  FY406_RS10410 - 915168..915335 (-) 168 WP_003086716.1 hypothetical protein -
  FY406_RS04475 (FY406_04475) - 915361..915642 (-) 282 WP_003086714.1 Blp family class II bacteriocin -
  FY406_RS04480 (FY406_04480) cipB 916280..916459 (+) 180 WP_003086713.1 Blp family class II bacteriocin Regulator
  FY406_RS04485 (FY406_04485) - 916496..916696 (+) 201 WP_003086708.1 Blp family class II bacteriocin -
  FY406_RS10415 - 916720..916884 (+) 165 WP_003086706.1 hypothetical protein -
  FY406_RS04490 (FY406_04490) glpK 916990..918510 (+) 1521 WP_003086704.1 glycerol kinase GlpK -
  FY406_RS04495 (FY406_04495) - 918757..919113 (-) 357 WP_003086701.1 hypothetical protein -
  FY406_RS04500 (FY406_04500) - 919157..919384 (-) 228 WP_225310764.1 bacteriocin-type signal sequence -
  FY406_RS04505 (FY406_04505) - 919601..920716 (+) 1116 WP_003086492.1 ISAs1 family transposase -

Sequence


Protein


Download         Length: 59 a.a.        Molecular weight: 5830.61 Da        Isoelectric Point: 3.5321

>NTDB_id=336842 FY406_RS04480 WP_003086713.1 916280..916459(+) (cipB) [Streptococcus ratti strain ATCC 31377]
MNTQAFERFDIMDNEALSTVEGGLSDCATGILGTGGLGAVGGPWGMVGGAMVGAAAFCF

Nucleotide


Download         Length: 180 bp        

>NTDB_id=336842 FY406_RS04480 WP_003086713.1 916280..916459(+) (cipB) [Streptococcus ratti strain ATCC 31377]
ATGAATACACAAGCATTTGAACGATTTGACATAATGGACAATGAAGCACTTTCAACTGTTGAAGGTGGACTTTCGGATTG
TGCAACGGGCATTCTTGGCACAGGCGGACTTGGCGCAGTTGGTGGCCCGTGGGGAATGGTTGGTGGAGCAATGGTCGGAG
CAGCAGCTTTTTGCTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

68.421

64.407

0.441


Multiple sequence alignment