Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPPC_RS00200 Genome accession   NC_014555
Coordinates   35570..35683 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   -
Organism   Helicobacter pylori PeCan4     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30570..40683
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPPC_RS00175 (HPPC_00155) - 30616..32841 (+) 2226 WP_001051493.1 AAA family ATPase -
  HPPC_RS00180 (HPPC_00160) panD 32831..33181 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HPPC_RS00185 (HPPC_00165) - 33192..33485 (+) 294 WP_000347166.1 YbaB/EbfC family nucleoid-associated protein -
  HPPC_RS00190 (HPPC_00170) - 33485..34492 (+) 1008 WP_000468452.1 PDZ domain-containing protein -
  HPPC_RS00195 (HPPC_00175) comB6 34498..35553 (+) 1056 WP_000786686.1 P-type conjugative transfer protein TrbL Machinery gene
  HPPC_RS00200 (HPPC_00180) comB7 35570..35683 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HPPC_RS00205 (HPPC_00185) comB8 35680..36423 (+) 744 WP_000660501.1 type IV secretion system protein Machinery gene
  HPPC_RS00210 (HPPC_00190) comB9 36423..37391 (+) 969 WP_013356092.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPPC_RS00215 (HPPC_00195) comB10 37384..38520 (+) 1137 WP_001045861.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPPC_RS00220 (HPPC_00200) - 38591..40003 (+) 1413 WP_000694802.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=33048 HPPC_RS00200 WP_001217868.1 35570..35683(+) (comB7) [Helicobacter pylori PeCan4]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=33048 HPPC_RS00200 WP_001217868.1 35570..35683(+) (comB7) [Helicobacter pylori PeCan4]
ATGAGAATTTTTTTTGTTATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACACTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment