Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   FNS63_RS06220 Genome accession   NZ_CP041770
Coordinates   1359003..1359317 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain DH8030     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1354003..1364317
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNS63_RS06175 (FNS63_06170) sinI 1354685..1354858 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  FNS63_RS06180 (FNS63_06175) sinR 1354892..1355227 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  FNS63_RS06185 (FNS63_06180) tasA 1355275..1356060 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  FNS63_RS06190 (FNS63_06185) sipW 1356124..1356708 (-) 585 WP_003153100.1 signal peptidase I SipW -
  FNS63_RS06195 (FNS63_06190) tapA 1356680..1357351 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  FNS63_RS06200 (FNS63_06195) - 1357611..1357940 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  FNS63_RS06205 (FNS63_06200) - 1357980..1358159 (-) 180 WP_003153093.1 YqzE family protein -
  FNS63_RS06210 (FNS63_06205) comGG 1358216..1358593 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  FNS63_RS06215 (FNS63_06210) comGF 1358594..1359094 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF Machinery gene
  FNS63_RS06220 (FNS63_06215) comGE 1359003..1359317 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  FNS63_RS06225 (FNS63_06220) comGD 1359301..1359738 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  FNS63_RS06230 (FNS63_06225) comGC 1359728..1359994 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  FNS63_RS06235 (FNS63_06230) comGB 1360041..1361078 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  FNS63_RS06240 (FNS63_06235) comGA 1361065..1362135 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  FNS63_RS06245 (FNS63_06240) - 1362327..1363277 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=328409 FNS63_RS06220 WP_015388003.1 1359003..1359317(-) (comGE) [Bacillus amyloliquefaciens strain DH8030]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=328409 FNS63_RS06220 WP_015388003.1 1359003..1359317(-) (comGE) [Bacillus amyloliquefaciens strain DH8030]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment