Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   BLCSL_RS13965 Genome accession   NZ_CP041154
Coordinates   2649223..2649660 (-) Length   145 a.a.
NCBI ID   WP_009327905.1    Uniprot ID   Q8VQ70
Organism   Bacillus licheniformis strain CSL2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2644223..2654660
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BLCSL_RS13915 (BLCSL_13915) sinI 2644398..2644574 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  BLCSL_RS13920 (BLCSL_13920) sinR 2644608..2644943 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  BLCSL_RS13925 (BLCSL_13925) tasA 2645048..2645842 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  BLCSL_RS13930 (BLCSL_13930) sipW 2645916..2646500 (-) 585 WP_003183449.1 signal peptidase I SipW -
  BLCSL_RS13935 (BLCSL_13935) tapA 2646497..2647225 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  BLCSL_RS13940 (BLCSL_13940) - 2647502..2647822 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  BLCSL_RS13945 (BLCSL_13945) - 2647846..2648028 (-) 183 WP_003183456.1 YqzE family protein -
  BLCSL_RS13950 (BLCSL_13950) comGG 2648117..2648482 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  BLCSL_RS13955 (BLCSL_13955) comGF 2648495..2648983 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  BLCSL_RS13960 (BLCSL_13960) comGE 2648892..2649239 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  BLCSL_RS13965 (BLCSL_13965) comGD 2649223..2649660 (-) 438 WP_009327905.1 competence type IV pilus minor pilin ComGD Machinery gene
  BLCSL_RS13970 (BLCSL_13970) comGC 2649666..2649959 (-) 294 WP_003183466.1 competence type IV pilus major pilin ComGC Machinery gene
  BLCSL_RS13975 (BLCSL_13975) comGB 2649973..2651007 (-) 1035 WP_011198115.1 competence type IV pilus assembly protein ComGB Machinery gene
  BLCSL_RS13980 (BLCSL_13980) comGA 2650997..2652061 (-) 1065 WP_003183477.1 competence type IV pilus ATPase ComGA Machinery gene
  BLCSL_RS13985 (BLCSL_13985) - 2652218..2653057 (-) 840 WP_003183480.1 STAS domain-containing protein -
  BLCSL_RS13995 (BLCSL_13995) - 2653299..2653676 (-) 378 WP_003183482.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  BLCSL_RS14000 (BLCSL_14000) - 2653885..2654130 (+) 246 WP_003183483.1 DUF2626 domain-containing protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16249.07 Da        Isoelectric Point: 9.6739

>NTDB_id=324960 BLCSL_RS13965 WP_009327905.1 2649223..2649660(-) (comGD) [Bacillus licheniformis strain CSL2]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=324960 BLCSL_RS13965 WP_009327905.1 2649223..2649660(-) (comGD) [Bacillus licheniformis strain CSL2]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8VQ70

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

39.86

98.621

0.393