Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   EC55989_RS05205 Genome accession   NC_011748
Coordinates   1084006..1084635 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli 55989     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1071503..1108778 1084006..1084635 within 0


Gene organization within MGE regions


Location: 1071503..1108778
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EC55989_RS05150 (EC55989_0998) uup 1072832..1074739 (+) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  EC55989_RS05155 (EC55989_0999) pqiA 1074869..1076122 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  EC55989_RS05160 (EC55989_1000) pqiB 1076127..1077767 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  EC55989_RS05165 (EC55989_1001) pqiC 1077764..1078327 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  EC55989_RS05170 (EC55989_1002) rmf 1078583..1078750 (+) 168 WP_000828648.1 ribosome modulation factor -
  EC55989_RS05175 (EC55989_1003) fabA 1078820..1079338 (-) 519 WP_001386684.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  EC55989_RS05180 (EC55989_1004) ycbZ 1079407..1081167 (-) 1761 WP_000156526.1 Lon protease family protein -
  EC55989_RS05185 (EC55989_1005) matP 1081353..1081805 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  EC55989_RS05190 (EC55989_1006) ompA 1081881..1082921 (-) 1041 WP_000750416.1 porin OmpA -
  EC55989_RS05200 (EC55989_1007) sulA 1083278..1083787 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  EC55989_RS05205 (EC55989_1008) sxy/tfoX 1084006..1084635 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  EC55989_RS05210 (EC55989_1009) yccS 1084598..1086760 (-) 2163 WP_000875044.1 YccS family putative transporter -
  EC55989_RS05215 (EC55989_1010) yccF 1086770..1087216 (-) 447 WP_001261243.1 YccF domain-containing protein -
  EC55989_RS05220 (EC55989_1011) helD 1087339..1089393 (+) 2055 WP_000420536.1 DNA helicase IV -
  EC55989_RS05225 (EC55989_1012) mgsA 1089425..1089883 (-) 459 WP_001386685.1 methylglyoxal synthase -
  EC55989_RS05230 (EC55989_1013) yccT 1089979..1090641 (-) 663 WP_000847785.1 DUF2057 family protein -
  EC55989_RS05240 (EC55989_1014) yccU 1090814..1091227 (+) 414 WP_000665217.1 CoA-binding protein -
  EC55989_RS05245 (EC55989_1015) hspQ 1091272..1091589 (-) 318 WP_001295356.1 heat shock protein HspQ -
  EC55989_RS05250 (EC55989_1016) rlmI 1091647..1092837 (-) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  EC55989_RS05255 yccX 1092932..1093210 (+) 279 WP_000048243.1 acylphosphatase -
  EC55989_RS05260 (EC55989_1018) tusE 1093207..1093536 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  EC55989_RS05265 (EC55989_1019) yccA 1093627..1094286 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  EC55989_RS05275 (EC55989_1021) - 1094694..1095713 (-) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  EC55989_RS05280 - 1095691..1095933 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  EC55989_RS05285 (EC55989_1023) - 1096001..1098493 (-) 2493 WP_000048485.1 exonuclease -
  EC55989_RS05290 (EC55989_1024) - 1098589..1098777 (-) 189 WP_000199480.1 DUF1482 family protein -
  EC55989_RS05295 dicB 1098774..1098962 (-) 189 WP_000449172.1 cell division inhibition protein DicB -
  EC55989_RS05300 (EC55989_1026) ydfC 1099530..1099748 (-) 219 WP_001171958.1 protein YdfC -
  EC55989_RS29875 (EC55989_1027) - 1099778..1099906 (-) 129 WP_000344925.1 hypothetical protein -
  EC55989_RS05305 (EC55989_1028) - 1099908..1100063 (-) 156 WP_000379557.1 DUF1391 family protein -
  EC55989_RS05310 (EC55989_1029) - 1100271..1100678 (-) 408 WP_000787428.1 helix-turn-helix domain-containing protein -
  EC55989_RS05315 (EC55989_1030) - 1100755..1100982 (+) 228 WP_000912294.1 Cro/CI family transcriptional regulator -
  EC55989_RS05320 (EC55989_1031) - 1100966..1101517 (+) 552 WP_000705383.1 toxin YdaT family protein -
  EC55989_RS05325 (EC55989_1032) - 1101489..1102529 (+) 1041 WP_000020540.1 DnaT-like ssDNA-binding domain-containing protein -
  EC55989_RS28600 (EC55989_1033) - 1102522..1102983 (+) 462 WP_000139447.1 replication protein P -
  EC55989_RS05335 (EC55989_1034) - 1103017..1103787 (+) 771 WP_000450707.1 DUF1627 domain-containing protein -
  EC55989_RS05340 (EC55989_1035) - 1103803..1104225 (+) 423 WP_001151117.1 DUF977 family protein -
  EC55989_RS05345 (EC55989_1036) - 1104222..1104710 (+) 489 WP_001275729.1 class I SAM-dependent methyltransferase -
  EC55989_RS05350 (EC55989_1037) - 1104703..1104957 (+) 255 WP_000520323.1 hypothetical protein -
  EC55989_RS05355 (EC55989_1038) - 1104950..1105261 (+) 312 WP_001002676.1 hypothetical protein -
  EC55989_RS05360 (EC55989_1039) - 1105390..1105572 (+) 183 WP_001224665.1 hypothetical protein -
  EC55989_RS29195 (EC55989_1040) - 1105565..1105741 (+) 177 WP_000753058.1 hypothetical protein -
  EC55989_RS05370 (EC55989_1041) - 1105738..1106253 (+) 516 WP_001290001.1 hypothetical protein -
  EC55989_RS05385 hokD 1107589..1107744 (+) 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD -
  EC55989_RS05390 (EC55989_1044) rem 1107961..1108212 (+) 252 WP_000980988.1 protein Rem -
  EC55989_RS27915 - 1108279..1108557 (+) 279 WP_001405664.1 hypothetical protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=32226 EC55989_RS05205 WP_000839153.1 1084006..1084635(+) (sxy/tfoX) [Escherichia coli 55989]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=32226 EC55989_RS05205 WP_000839153.1 1084006..1084635(+) (sxy/tfoX) [Escherichia coli 55989]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1

Multiple sequence alignment