Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   ETT44_RS09480 Genome accession   NZ_CP035455
Coordinates   1419789..1420007 (-) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm197     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 1414789..1425007
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT44_RS07390 (ETT44_07380) - 1415500..1415817 (-) 318 WP_002994587.1 hypothetical protein -
  ETT44_RS07395 (ETT44_07385) - 1415866..1416093 (-) 228 WP_136021931.1 Blp family class II bacteriocin -
  ETT44_RS09570 - 1416491..1416619 (-) 129 WP_002994583.1 hypothetical protein -
  ETT44_RS09640 (ETT44_07390) - 1416704..1417015 (-) 312 WP_225793061.1 CPBP family intramembrane glutamic endopeptidase -
  ETT44_RS09335 - 1417310..1417486 (-) 177 WP_168392902.1 hypothetical protein -
  ETT44_RS07405 (ETT44_07395) - 1417464..1417688 (-) 225 WP_002994580.1 Blp family class II bacteriocin -
  ETT44_RS09475 - 1417986..1419568 (+) 1583 Protein_1372 ABC transporter transmembrane domain-containing protein -
  ETT44_RS09480 comE/blpR 1419789..1420007 (-) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  ETT44_RS09485 (ETT44_07420) - 1420308..1420562 (+) 255 WP_010921971.1 hypothetical protein -
  ETT44_RS07435 (ETT44_07425) - 1420869..1421345 (-) 477 WP_111717876.1 NUDIX hydrolase -
  ETT44_RS07440 (ETT44_07430) era 1421366..1422262 (-) 897 WP_002985743.1 GTPase Era -
  ETT44_RS07445 (ETT44_07435) - 1422382..1422789 (-) 408 WP_002985746.1 diacylglycerol kinase family protein -
  ETT44_RS07450 (ETT44_07440) ybeY 1422770..1423267 (-) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  ETT44_RS07455 (ETT44_07445) - 1423426..1424001 (-) 576 WP_002985750.1 uracil-DNA glycosylase family protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=303609 ETT44_RS09480 WP_072135532.1 1419789..1420007(-) (comE/blpR) [Streptococcus pyogenes strain emm197]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=303609 ETT44_RS09480 WP_072135532.1 1419789..1420007(-) (comE/blpR) [Streptococcus pyogenes strain emm197]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417