Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT57_RS00685 Genome accession   NZ_CP035442
Coordinates   104562..104846 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm25     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99562..109846
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT57_RS00660 (ETT57_00660) - 101508..101873 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT57_RS00665 (ETT57_00665) comGA 101966..102904 (+) 939 WP_009880361.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT57_RS00670 (ETT57_00670) comGB 102840..103874 (+) 1035 WP_227877779.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT57_RS00675 (ETT57_00675) comGC 103876..104202 (+) 327 WP_053308148.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT57_RS00680 (ETT57_00680) comGD 104177..104605 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT57_RS00685 (ETT57_00685) comGE 104562..104846 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT57_RS00690 (ETT57_00690) comGF 104839..105273 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT57_RS00695 (ETT57_00695) comGG 105257..105583 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT57_RS00700 (ETT57_00700) comGH 105681..106634 (+) 954 WP_053308149.1 class I SAM-dependent methyltransferase Machinery gene
  ETT57_RS00705 (ETT57_00705) - 106693..107889 (+) 1197 WP_002987791.1 acetate kinase -
  ETT57_RS00710 (ETT57_00710) - 108075..108383 (+) 309 Protein_90 hypothetical protein -
  ETT57_RS00715 (ETT57_00715) proC 108466..109236 (-) 771 WP_011284426.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=302283 ETT57_RS00685 WP_011284422.1 104562..104846(+) (comGE) [Streptococcus pyogenes strain emm25]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=302283 ETT57_RS00685 WP_011284422.1 104562..104846(+) (comGE) [Streptococcus pyogenes strain emm25]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383