Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ETT68_RS00680 Genome accession   NZ_CP035431
Coordinates   104414..104698 (+) Length   94 a.a.
NCBI ID   WP_265416309.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm105     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99414..109698
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT68_RS00655 (ETT68_00655) - 101360..101725 (+) 366 WP_002986560.1 DUF1033 family protein -
  ETT68_RS00660 (ETT68_00660) comGA 101818..102756 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  ETT68_RS00665 (ETT68_00665) comGB 102692..103726 (+) 1035 WP_227876939.1 competence type IV pilus assembly protein ComGB Machinery gene
  ETT68_RS00670 (ETT68_00670) comGC 103728..104054 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  ETT68_RS00675 (ETT68_00675) comGD 104029..104457 (+) 429 WP_109991901.1 competence type IV pilus minor pilin ComGD Machinery gene
  ETT68_RS00680 (ETT68_00680) comGE 104414..104698 (+) 285 WP_265416309.1 competence type IV pilus minor pilin ComGE Machinery gene
  ETT68_RS00685 (ETT68_00685) comGF 104691..105125 (+) 435 WP_109991902.1 competence type IV pilus minor pilin ComGF Machinery gene
  ETT68_RS00690 (ETT68_00690) comGG 105109..105435 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  ETT68_RS00695 (ETT68_00695) comGH 105533..106486 (+) 954 WP_136038165.1 class I SAM-dependent methyltransferase Machinery gene
  ETT68_RS00700 (ETT68_00700) - 106545..107741 (+) 1197 WP_030126459.1 acetate kinase -
  ETT68_RS00705 (ETT68_00705) - 107927..108235 (+) 309 Protein_89 hypothetical protein -
  ETT68_RS00710 (ETT68_00710) proC 108318..109088 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10702.71 Da        Isoelectric Point: 8.9043

>NTDB_id=301249 ETT68_RS00680 WP_265416309.1 104414..104698(+) (comGE) [Streptococcus pyogenes strain emm105]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRMDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=301249 ETT68_RS00680 WP_265416309.1 104414..104698(+) (comGE) [Streptococcus pyogenes strain emm105]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGTAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTATGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment